close all open/close all

CDS information : Lydi_00040


close this sectionLocation

Organism
StrainTP-A0598 (=NBRC 110027)
Entry nameLydicamycin
Contig
Start / Stop / Direction7,438 / 9,336 / + [in whole cluster]
7,438 / 9,336 / + [in contig]
Location7438..9336 [in whole cluster]
7438..9336 [in contig]
TypeCDS
Length1,899 bp (632 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative two-component system histidine kinase
Product (GenBank)putative two-component histidine kinase
GeneTPA0598_03_00680
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[26380643] Draft genome sequence of marine-derived Streptomyces sp. TP-A0598, a producer of anti-MRSA antibiotic lydicamycins. (Stand Genomic Sci. , 2015)
Family/Domain
FD
IPR011712
FD
IPR003594

close this sectionSequence

selected fasta
>putative two-component system histidine kinase [putative two-component histidine kinase]
MFGRHLWAPLRGLVLFGLGLTAGPMLAAIGLGMLFGIQSLAQWYRDPLNVYRTFAGRWCG
VDIPVPYQPPPPPPEPEPDGWYRYKNRLYLTPKKLSYERRWDWLVKDPATSRDILWMLIN
PIAGSFTALLPLTLVVVGATSPWYWPGHPGITVPVAVATALAGFGFGPALLHLHGRWTCQ
LLASAADSGIRRALIRIGRGGLATWRLALTAGLAVAELAAALMHLLAMVPILLWAWPTVL
VAGRQLTSWRRQQIQEWTGIRIDRPYLPEPVLPPPRPDGTYQIGRTLYRTPEMALRSLRY
RQNARDLATWRDLLWLLLDPVVGVLLAAVPVLVTGYCFFGLIWSWAWASLLQLFVDFHTF
ESWPLLTRGVPVLGDYPIATAPLIGVVGTLTGSLLAIPLLRLHGLWSWLLLGPTKSALLG
RRVDQLTETRMEARETLSSELRRIERDLHDGAQAQWVAMGMKLGAIEALIERDPAAAKTM
VGTAREASAKALIELRHLIRGINPPVLAERGIADAIRGLALDSPLSVGLRIELPGRPERP
VESAAYFAVSELLTNVSKHADAGRVHIDVRYTANQLRIALTDNGVGGADPAKGSGLRGVQ
RRLATFDGSLAVHSPLGGPTTVTLEIPCVLSS
selected fasta
>putative two-component system histidine kinase [putative two-component histidine kinase]
ATGTTCGGACGGCACCTCTGGGCGCCCCTGCGCGGCCTTGTGCTCTTCGGGCTGGGACTC
ACCGCCGGGCCGATGCTGGCCGCCATCGGCCTCGGCATGCTCTTCGGCATCCAGTCGCTT
GCCCAGTGGTACCGCGATCCGCTCAACGTCTACCGCACCTTCGCCGGCCGGTGGTGCGGG
GTGGACATCCCGGTGCCGTACCAGCCCCCGCCGCCACCACCCGAACCCGAACCCGACGGC
TGGTACCGCTACAAGAACCGGCTCTACCTGACCCCGAAGAAGCTCTCCTACGAACGGCGC
TGGGACTGGCTGGTCAAGGACCCGGCCACCTCCCGGGACATCCTCTGGATGCTGATCAAC
CCCATCGCCGGAAGCTTCACGGCGCTGCTGCCGCTCACCCTGGTCGTGGTGGGCGCCACC
TCCCCGTGGTACTGGCCCGGACACCCCGGAATCACCGTCCCGGTCGCCGTGGCGACGGCA
CTGGCCGGCTTCGGGTTCGGGCCGGCCCTGCTCCATCTGCACGGCCGCTGGACCTGCCAA
CTCCTCGCGTCCGCCGCCGACTCCGGAATACGCCGTGCGCTGATCCGGATCGGCCGTGGG
GGGCTCGCCACCTGGCGGCTGGCCCTGACCGCCGGGCTCGCGGTCGCCGAACTGGCCGCC
GCCCTCATGCATCTGCTGGCGATGGTGCCGATCCTGCTGTGGGCCTGGCCGACCGTGCTG
GTCGCCGGCCGGCAGCTCACCTCCTGGCGCCGGCAGCAGATCCAGGAGTGGACCGGCATC
CGGATCGACCGGCCCTATCTGCCCGAACCGGTGCTGCCACCACCCCGGCCCGACGGCACG
TACCAGATCGGCCGCACGCTGTACCGCACCCCGGAGATGGCGCTGCGGTCCCTGCGGTAC
CGGCAGAACGCCCGGGACCTGGCCACTTGGCGGGACCTGCTGTGGCTGCTGCTCGACCCG
GTCGTGGGGGTGCTGCTCGCCGCGGTCCCCGTGCTGGTCACCGGATACTGCTTCTTCGGC
CTGATCTGGTCCTGGGCCTGGGCCTCGCTGCTTCAGCTCTTCGTCGACTTCCACACCTTC
GAGAGCTGGCCCCTGCTGACCCGTGGCGTCCCGGTCCTCGGCGACTACCCGATCGCCACC
GCCCCCCTGATCGGTGTGGTCGGCACCCTGACCGGCAGTCTGCTCGCCATCCCGCTGCTG
CGGCTGCACGGCCTGTGGAGCTGGCTCCTGCTCGGGCCCACCAAGTCGGCGCTGCTCGGC
CGCCGGGTGGACCAGCTCACCGAGACCCGGATGGAGGCCCGGGAGACCCTCTCTTCGGAG
CTGCGCCGGATCGAACGCGATCTGCACGACGGGGCGCAGGCGCAGTGGGTGGCCATGGGG
ATGAAACTCGGCGCCATCGAGGCCCTCATCGAACGGGACCCGGCTGCTGCCAAGACGATG
GTCGGGACCGCCAGGGAAGCCTCCGCGAAGGCGCTCATCGAGTTACGCCATCTGATCCGC
GGCATCAACCCGCCGGTGCTCGCCGAACGCGGTATCGCGGACGCCATCCGCGGACTGGCC
CTGGACTCGCCGCTCTCCGTCGGTCTGCGGATCGAGCTGCCCGGCCGTCCCGAGCGCCCG
GTCGAATCCGCCGCCTATTTCGCGGTGTCCGAACTGCTCACCAATGTTTCCAAACACGCC
GACGCGGGCCGTGTGCACATCGATGTGCGCTACACGGCGAACCAGCTGCGGATCGCGCTC
ACCGACAACGGGGTCGGGGGCGCCGATCCGGCGAAGGGCAGCGGGCTGCGCGGCGTCCAG
CGGCGGCTCGCTACCTTCGACGGAAGTCTCGCCGTGCACAGTCCACTCGGCGGCCCCACC
ACAGTCACTCTGGAGATTCCGTGCGTGTTGTCCTCGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003594 ATPase-like, ATP-binding domain (Domain)
 [512-631]  2e-15 SSF55874
SSF55874   ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase
 [545-627]  1.8e-09 PF02518
PF02518   HATPase_c
 [548-628]  1.4e-07 G3DSA:3.30.565.10
G3DSA:3.30.565.10   no description
 [540-630]  0.0091 SM00387
SM00387   Histidine kinase-like ATPases
IPR011712 Signal transduction histidine kinase, subgroup 3, dimerisation and phosphoacceptor domain (Domain)
 [440-507]  6.6e-13 PF07730
PF07730   HisKA_3
IPR025828 Putative sensor domain (Domain)
 [12-178]  1.5e-10 PF13796 [210-411]  1.1e-13 PF13796
PF13796   Sensor
SignalP No significant hit
TMHMM
 [15-37]  Transmembrane (o-i) [114-136]  Transmembrane (i-o) [151-173]  Transmembrane (o-i) [194-216]  Transmembrane (i-o) [221-243]  Transmembrane (o-i) [313-347]  Transmembrane (i-o) [378-400]  Transmembrane (o-i)
Transmembrane 7