close all open/close all

CDS information : Lydi_00050


close this sectionLocation

Organism
StrainTP-A0598 (=NBRC 110027)
Entry nameLydicamycin
Contig
Start / Stop / Direction9,318 / 9,974 / + [in whole cluster]
9,318 / 9,974 / + [in contig]
Location9318..9974 [in whole cluster]
9318..9974 [in contig]
TypeCDS
Length657 bp (218 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative two-component system response regulator
Product (GenBank)putative two-component response regulator
GeneTPA0598_03_00690
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[26380643] Draft genome sequence of marine-derived Streptomyces sp. TP-A0598, a producer of anti-MRSA antibiotic lydicamycins. (Stand Genomic Sci. , 2015)
Related Reference
ACC
Q54821
NITE
Adria_00100
PmId
[7868594] Regulation of daunorubicin production in Streptomyces peucetius by the dnrR2 locus. (J Bacteriol. , 1995)
[8892835] The DnrN protein of Streptomyces peucetius, a pseudo-response regulator, is a DNA-binding protein involved in the regulation of daunorubicin biosynthesis. (J Bacteriol. , 1996)
[10846224] The dnrO gene encodes a DNA-binding protein that regulates daunorubicin production in Streptomyces peucetius by controlling expression of the dnrN pseudo response regulator gene. (Microbiology. , 2000)
[20122958] The activator/repressor protein DnrO of Streptomyces peucetius binds to DNA without changing its topology. (Int J Biol Macromol. , 2010)
[20529134] Modulation of dnrN expression by intracellular levels of DnrO and daunorubicin in Streptomyces peucetius. (FEMS Microbiol Lett. , 2010)
[20158521] Daunorubicin efflux in Streptomyces peucetius modulates biosynthesis by feedback regulation. (FEMS Microbiol Lett. , 2010)
Family/Domain
FD
IPR001789, IPR000792

close this sectionSequence

selected fasta
>putative two-component system response regulator [putative two-component response regulator]
MRVVLVEDLYLLREGLTHLLTAHGFEVVSAVETGPELLTAVEEHRPDVAIVDVRLPPTFT
DEGLQAAHEARRRIPGLPVLVLSQHVEQLYARELLADGSGAIGYLLKDRVFNATQFVDAL
RRVAEGGTAMDPEVISKLVESNAHQEPLGTLTAREREVLELMAEGCSNAAVSHRLYISEG
AVSKHIASVFGKLNLTNSNDTNRRVLAVLAYLNSANLD
selected fasta
>putative two-component system response regulator [putative two-component response regulator]
GTGCGTGTTGTCCTCGTAGAGGACCTCTACCTGCTTCGCGAAGGTCTGACCCATCTGCTC
ACCGCGCACGGCTTCGAGGTGGTCTCCGCCGTCGAGACCGGCCCGGAGCTGCTCACGGCC
GTGGAGGAGCACCGGCCCGATGTCGCGATCGTGGATGTCCGGCTACCGCCCACGTTCACC
GACGAGGGGCTCCAGGCGGCGCACGAGGCCCGTCGGCGGATCCCCGGTCTGCCCGTCCTG
GTGCTGTCCCAGCACGTCGAGCAGCTCTATGCGCGCGAACTGCTGGCCGACGGGTCCGGC
GCCATCGGATATCTGCTGAAGGACCGGGTGTTCAACGCCACGCAGTTCGTGGACGCGCTG
CGCCGGGTCGCCGAGGGCGGCACCGCGATGGACCCGGAGGTCATCTCCAAACTGGTGGAG
AGCAACGCCCATCAGGAGCCACTGGGCACCCTGACCGCCCGGGAACGGGAGGTCCTGGAG
CTGATGGCCGAGGGCTGTTCCAACGCGGCGGTCTCGCACCGCCTCTACATCAGCGAAGGC
GCGGTGAGCAAACACATCGCCAGCGTCTTCGGCAAGCTGAATCTGACCAACTCCAATGAC
ACCAACCGCCGGGTGCTCGCGGTCCTCGCCTATCTGAACAGCGCGAACCTGGACTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000792 Transcription regulator LuxR, C-terminal (Domain)
 [151-165]  3.1e-09 PR00038 [165-181]  3.1e-09 PR00038 [181-193]  3.1e-09 PR00038
PR00038   HTHLUXR
 [148-210]  5e-14 SM00421
SM00421   helix_turn_helix, Lux Regulon
 [144-209]  20.002 PS50043
PS50043   HTH_LUXR_2
 [150-198]  1.7e-13 PF00196
PF00196   GerE
IPR001789 Signal transduction response regulator, receiver domain (Domain)
 [1-120]  1.5e-15 SM00448
SM00448   cheY-homologous receiver domain
 [2-99]  19.448 PS50110
PS50110   RESPONSE_REGULATORY
 [3-108]  1.7e-16 PF00072
PF00072   Response_reg
IPR011006 CheY-like superfamily (Domain)
 [1-185]  3.2e-22 SSF52172
SSF52172   CheY-like
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [126-203]  1.9e-22 G3DSA:1.10.10.10
G3DSA:1.10.10.10   no description
SignalP No significant hit
TMHMM No significant hit