close all open/close all

CDS information : Lydi_00060


close this sectionLocation

Organism
StrainTP-A0598 (=NBRC 110027)
Entry nameLydicamycin
Contig
Start / Stop / Direction11,060 / 10,050 / - [in whole cluster]
11,060 / 10,050 / - [in contig]
Locationcomplement(10050..11060) [in whole cluster]
complement(10050..11060) [in contig]
TypeCDS
Length1,011 bp (336 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productputative acyltransferase
Product (GenBank)putative acyltransferase
GeneTPA0598_03_00700
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[26380643] Draft genome sequence of marine-derived Streptomyces sp. TP-A0598, a producer of anti-MRSA antibiotic lydicamycins. (Stand Genomic Sci. , 2015)
Related Reference
ACC
Q52V48
PmId
[15844935] Microbial genomics as a guide to drug discovery and structural elucidation: ECO-02301, a novel antifungal agent, as an example. (J Nat Prod. , 2005)
ACC
Q76KY5
NITE
Vicen_00150
PmId
[22010945] A natural protecting group strategy to carry an amino acid starter unit in the biosynthesis of macrolactam polyketide antibiotics. (J Am Chem Soc. , 2011)
[26831085] Structure-based analysis of the molecular interactions between acyltransferase and acyl carrier protein in vicenistatin biosynthesis. (Proc Natl Acad Sci U S A. , 2016)

close this sectionSequence

selected fasta
>putative acyltransferase [putative acyltransferase]
MGRTEAQAGGSPIAPAVERDSGRASRTAVLFPGMGRFDFASAGRFLVLDRYARARLAVAD
EVLGFSVLERFHDAGADYSEYAQLAFLIASLAAADRAEDRFGMRPDVCAGASFGQKAAAA
YAGSLDFPDVVRMTAELARCEKEYFTTEHSDVVTHAVYRVPDEEFHALLDEMRARGDWFE
ISGELDRGFYMVSLPESRLEDFIRAVRDLGGYSMYTMRPPVHARAFGALRRKAEAEVFTK
YRIKAPRLPVISDADGTVVESAEAMRTMLLDTFDRAIHWPAMVTSMAGLGVDTLHVTGAD
DMFHRLNCTARAFDVLTVNPKNALRPGPPKLRSRAA
selected fasta
>putative acyltransferase [putative acyltransferase]
ATGGGTCGGACTGAAGCGCAAGCCGGGGGCTCCCCCATCGCGCCGGCCGTCGAGCGAGAC
TCCGGCAGGGCGTCGCGGACCGCCGTACTGTTCCCCGGCATGGGCCGGTTCGATTTCGCG
AGCGCCGGCCGGTTCCTGGTGCTCGACCGGTATGCCCGCGCCCGGCTCGCGGTCGCCGAC
GAGGTGCTCGGCTTCTCCGTGCTGGAACGGTTCCACGACGCCGGCGCCGACTACTCCGAG
TACGCCCAGTTGGCCTTTCTGATCGCTTCGCTCGCCGCCGCCGACCGGGCCGAGGACCGG
TTCGGTATGCGGCCCGACGTCTGTGCCGGGGCCAGCTTCGGCCAGAAGGCGGCGGCTGCG
TACGCCGGTTCGCTCGATTTCCCCGATGTCGTACGGATGACGGCGGAGCTGGCGCGCTGC
GAGAAGGAGTACTTCACCACCGAGCACTCGGACGTGGTGACCCACGCCGTTTACCGCGTC
CCGGACGAGGAGTTCCACGCCCTGCTGGACGAAATGCGGGCGCGGGGCGACTGGTTCGAG
ATTTCCGGCGAGCTGGACCGCGGGTTCTACATGGTGTCCCTGCCGGAATCGCGGCTGGAG
GATTTCATCCGGGCGGTGCGGGACCTCGGCGGATACTCGATGTACACCATGCGCCCGCCG
GTGCATGCCCGTGCGTTCGGCGCACTGCGCCGCAAGGCGGAGGCCGAGGTCTTCACCAAG
TACCGGATCAAGGCGCCCCGGCTCCCCGTCATCTCGGACGCCGACGGCACGGTGGTGGAG
TCCGCCGAGGCGATGCGGACCATGCTGCTGGACACCTTCGACCGGGCGATCCACTGGCCG
GCCATGGTGACCTCGATGGCCGGCCTCGGCGTGGACACGCTCCATGTCACCGGCGCCGAT
GACATGTTCCACCGGCTGAACTGCACCGCCCGTGCCTTCGACGTCCTCACGGTCAACCCG
AAGAACGCCCTGCGCCCGGGGCCCCCGAAGCTCCGCAGCCGGGCCGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [218-304]  2.3e-21 G3DSA:3.40.366.10
G3DSA:3.40.366.10   no description
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [26-328]  1.3e-25 SSF52151
SSF52151   FabD/lysophospholipase-like
SignalP No significant hit
TMHMM No significant hit