close all open/close all

CDS information : Lydi_00070


close this sectionLocation

Organism
StrainTP-A0598 (=NBRC 110027)
Entry nameLydicamycin
Contig
Start / Stop / Direction11,434 / 11,063 / - [in whole cluster]
11,434 / 11,063 / - [in contig]
Locationcomplement(11063..11434) [in whole cluster]
complement(11063..11434) [in contig]
TypeCDS
Length372 bp (123 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical protein
GeneTPA0598_03_00710
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[26380643] Draft genome sequence of marine-derived Streptomyces sp. TP-A0598, a producer of anti-MRSA antibiotic lydicamycins. (Stand Genomic Sci. , 2015)

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical protein]
MPRGAASVRVIALAVVLLTAGCTDKGHSNKASDIKDKASACVKALRIVDLVPDPKKAEDY
EKKGKELRELAKDVRDRDVAKAMRQVAHQYGMARTEAARDFGRVAVWVKGTVTNIKALKK
VCA
selected fasta
>hypothetical protein [hypothetical protein]
ATGCCCAGGGGGGCGGCCAGCGTCCGTGTCATCGCGTTAGCAGTGGTACTGCTGACCGCG
GGATGCACGGACAAGGGGCATTCCAATAAGGCGTCCGACATCAAGGACAAAGCCTCGGCC
TGTGTGAAGGCACTGCGGATCGTCGATCTGGTGCCGGACCCGAAAAAGGCCGAGGACTAC
GAGAAAAAGGGCAAGGAATTACGCGAGCTGGCGAAGGACGTACGTGACCGTGATGTCGCG
AAGGCCATGCGCCAGGTGGCCCATCAATATGGCATGGCACGCACGGAGGCCGCCCGCGAT
TTCGGCCGGGTGGCGGTATGGGTCAAGGGAACCGTCACCAACATCAAAGCACTGAAAAAG
GTGTGTGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP
 [1-31]  0.489 Signal
Bacteria, Gram-positive   
 [1-28]  0.597 Signal
Eukaryota   
TMHMM No significant hit