close all open/close all

CDS information : Lydi_00090


close this sectionLocation

Organism
StrainTP-A0598 (=NBRC 110027)
Entry nameLydicamycin
Contig
Start / Stop / Direction12,194 / 11,952 / - [in whole cluster]
12,194 / 11,952 / - [in contig]
Locationcomplement(11952..12194) [in whole cluster]
complement(11952..12194) [in contig]
TypeCDS
Length243 bp (80 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)O-acetyltransferase
GeneTPA0598_03_00730
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[26380643] Draft genome sequence of marine-derived Streptomyces sp. TP-A0598, a producer of anti-MRSA antibiotic lydicamycins. (Stand Genomic Sci. , 2015)

close this sectionSequence

selected fasta
>hypothetical protein [O-acetyltransferase]
MTPKDTERHDTAAAHTAAADPAAPGAASFALMRARIEAEQSASQEFQARQIPLRLTAGHA
TESPVGTPTPSPPLRDIAQP
selected fasta
>hypothetical protein [O-acetyltransferase]
ATGACACCGAAAGACACCGAACGCCACGACACCGCTGCGGCGCACACGGCGGCGGCAGAC
CCTGCCGCGCCGGGCGCCGCATCATTCGCCCTGATGAGGGCGCGCATTGAGGCCGAGCAG
TCGGCTTCCCAAGAATTCCAAGCTCGACAGATCCCCCTTCGACTCACTGCGGGCCACGCT
ACGGAATCGCCGGTGGGTACTCCAACCCCTAGCCCTCCCCTAAGGGATATCGCGCAACCC
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
No significant hit
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit