close all open/close all

CDS information : Lydi_00100


close this sectionLocation

Organism
StrainTP-A0598 (=NBRC 110027)
Entry nameLydicamycin
Contig
Start / Stop / Direction12,237 / 23,033 / + [in whole cluster]
12,237 / 23,033 / + [in contig]
Location12237..23033 [in whole cluster]
12237..23033 [in contig]
TypeCDS
Length10,797 bp (3,598 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)polyketide synthase
GeneTPA0598_03_00740
Gene (GenBank)
EC number
Keyword
Note
  • The N-terminal position was modified from original publication.
Note (GenBank)
Reference
ACC
PmId
[26380643] Draft genome sequence of marine-derived Streptomyces sp. TP-A0598, a producer of anti-MRSA antibiotic lydicamycins. (Stand Genomic Sci. , 2015)

close this sectionPKS/NRPS Module

2 malonyl-CoA
3 methylmalonyl-CoA
KS35..411
AT572..890
dh936..1101
KR1404..1584
ACP1686..1756
KS1779..2155
AT2322..2638
DH2684..2848
KR3163..3343
ACP3444..3514

close this sectionSequence

selected fasta
>polyketide synthase [polyketide synthase]
MANNEGKLLEYLKRTTAELRDTRARLTETERKESEPIAIVGMACRYPGGVSSPEELWDVV
SAGTDGVSEFPVDRGWDVDSLYHPDPEHLGTSYTREGGFLHGAAEFDPGFFGISPHEAVA
MDPQQRLLLEVSWEAIERAGIDPTSLRGSKTGVFTGVMYHDYGSGVSGVSEDIAAFQGNG
ADSSVVSGRVAYLFGLEGQAVTVDTACSSSLVALHWAIQALRAGECSMALAGGVTVMFTP
ETFIDFSRQRGLAADGRCKSFAAAADGTGWGEGAGVLLVERLSDARRNGHPVLAVVRGSA
VNQDGASSGLTAPNGPAQQRVIRQALANARLSTGDVDAVEAHGTGTRLGDPIEAQALLAT
YGQDRPEEQPLYLGSIKSNLGHTQAAAGVAGVMKMVLAMRHGMLPKTLHVDEPSPHVDWS
AGSVELLTQEREWPDSGHPRRAGVSSFGISGTNAHVVLEQAPEPEPDDAQPADPEDVPAT
AASGTGLVPWVLSARSREALAAQAGRLASHVASRPELDPVDIGFSLVTTRAGLDYRAAVT
GTGREELLAGLRALAEDTEQPRAVSEGRLATLFTGQGAQRLGMGRELHAAYPVFARAWDE
VCAEFDGLLPRPLTEVVWAAPGGGEEELLHQTQYAQAALFALEVALFRLVESYGVVPDVL
LGHSIGEVTAAHLAGVWSLADAAKLVAARGRLMQALPSGGVMVSAAASEDEVRALLEGRE
RIGIAAVNGPASVVISGAAEPVEQVVAVLESRGRKVKGLRVSHAFHSPLMDPMLAEFRTV
VEQLTYSEPRLPVVSNVTGRLADPAELRDPEYWVRHVREAVRFHDGIQAAHADGVTTFLE
LGPGGVLSAMGRDCLPEDDTVTFQPSLRTPLADPEALLKALTGLWTRGVRVDCAALLPGG
RRVDLPTYAFQRGRYWLEGAAGGADVTSAGLGAGNHPLLGAVLPLPGSDGFLLTGRLSLA
THPWLADHVVLGTVVLPGSALVELAVQAGDQAGCTLIDELTVLDPLVLPARGGVRIQLTV
DAPDEHGRRELSVFSKPEDAEDTRPWTRHATGVLAAGATAPAPAFPETAWPPADAEPLMV
EGLYDELAATGFGYGPVFQGVRAAWRRGEDLYAEVALPDEPAAQADTYGLHPALLEAVLQ
TLSRAESAADGPRLPASWTGFRLHAVGATTLRVKISPAGADGFSVVAADADNAVVASVDR
VTRRAVTTDELATDANPSDSLYRLDWTPVPVAERTGGSWAVLGDDPALAAALGASVLDPD
DTDAPVPDTVVLPVIGATSGAVPDAVRETTHQLLARLQWWLAEERFAGTRLVVLTRGAVS
VAEEPVDLVTAPAWGLVHSTQSEHPDRLVLVDIDDDTRSLDVLPAVTDAGEPELAIRGGL
VSAPRLAQLLAPEREPEPVWTADGTVLVTGGTGSLGAITARHLVADLGVRHLLLTSRRGM
AAEGAAELRDELTALGARVTIAACDTADREALAALLATVPADAPLRGVVHTAGVLDDGVL
ASLNPERMDKVLRPKVDAAWNLHELTRDLDLSAFILFSAACSVFDAPGQANYVAANAFLD
ALAEHRHGLGLPCVSLAWGLWAQDGGGMAGGLGENDLRRMARKGIVAQTPDEGMRMFDGA
VRSGAPLVVPVRLDINVLAVTGDFPPMLHGLVPFRRRTAAAAGAGTGDSLRERLAPLPQT
DQDRALMDLVTAQIALVLGYAGGGAVETTRAFRDLGFDSLTAVELRNRLDTATGLSLSAT
LVFDYPTPVALVRHLREQLLGASAAPVAVRSTAPATDDDPIVIVGMACRFPGQVASPEDL
WHLLVSGGDAISAFPENRGWDVEGIYDPDPGRSGKTYTREGGFLYDVADFDASFFEINPR
EALATDPQQRILLETVWEAFENAGIDPTTLRGSKTGVFAGVSYHDYAPPSGQIPEDLEGY
VGTGSAGSVLSGRVSYTFGFEGPAVTVDTACSSSLVALHWAIQALRTGECTLALAGGVSV
MSTPDTFVDFSRQRGLSADGRCKAFAAAADGTGWGEGVGMVLVERLSDARRNGHTVLAVV
RGTAVNQDGASNGLTAPNGPSQQRVIEQALANAGVTADQVDAVEAHGTGTTLGDPIEAQA
LIATYGRERIADRPLLLGSIKSNIGHTQAAAGMAGVMKMVLAMRHGLLPKTLHVDEPTPH
VDWSAGTVELLTELRQWPKTGEPWRAGVSSFGISGTNAHVVLEQAPVAEPVAVEPDTTGP
AGGASAGLVPWVLSARSEQALVAQADRLASFVEERPELSVADVGFSLVASRAELEHRAVV
VGADQDQLLSGLRGLAGGFAGGLDGAGVVQGSVAATAASGAVLVFPGQGSQWLGMADELL
AASPVFAGRMAECGAALSEFVSWKLDEVLSDEDMLTRVDVVQPVLWAVMVSLAAVWEDCG
VVPAAVVGHSQGEIAAACVAGILSLRDGARVVALRSQAIGRVLAGRGGMVSVAGSREAVQ
ERIAKWGEQLSVAALNGPSATVVSGDPDALQELLAECAEQDVRARKIPVDYASHGAQVEL
LREELATVLAEVRPGQGRIPFYSAVHASLISGEELDAAYWFENLRNTVRFEEAIQALLAD
GHGVFVECSAHPVLTPGIEDTAQEASSPVVVTGTLRRDEGGWSRFAQSLGQLWAHGVPVD
WSTLLPAGRRVDLPTYAFQRQRYWLETSSGAGDVSSVGLGAADHPLLGAAVALPDSDGFL
FTGRLSLATHRWLADHSVLDTVLVPGTGLVELAIRAGDQVGCDLLEELTLESPLIIAPTG
GVQLRVTVGEPDENGRRNLAVFSRDEDAAAGQPWTRHATGTLAVGTGTPAARGEESWPPA
GAEAVPVDGFYGGLAEAGYEYGPVFQGLRAAWRRGEDIFAEVALPEEAVGEAGRFGLHPA
LLDAVLHTVGLGEAHGDEGPGLPFAWTGVQLHAVGATALRARLSKAGESGVRVEVSDATG
VPVATVESLVMREVSADQLRAAGSGRDAVFRLDWTELPGLTGRVIETSMAVVGPAADEFA
GSLRAAGIEAGTAADLVVLGKQDTVPEYVLLPVPAAGAGAVPDAVRSAVHQVLGTVQSWL
AESRFADAKLVVLTQGAVAASGESPDLALAPVWGLVRSAQSENPGRIVLADVDGEVSSLR
ALPGLLAEAEPQLAVRGGVAAAPRLARFGPVDTDREPVWAGHGTVLITGGTGMLAGLVAR
HLVAEHGAKRLILAGRRGLAADGAARLRDELTALGAHVEVVACDAADRDALGALLAGIPA
DAPLTGVVHTAGVLDDGLIGALTPERIETVLRPKVDAAWNLHELTKERDLSAFVLFSSAS
GVLGAPGQANYAAASTFLDALAEHRHAHGLPALSLAWGLWSERSDLTRKLTETDLRRMNR
EGLPPMSSEEGVALFDVVGAAETPVVIPVALDAKKVAAAGEVPAVLRGLVRAPARRTVSA
GPASAKSLRDRLAEVPPAERAAVVLELVRNHTAMVLGHSGADMVNADQSFSELGFDSLTA
VELRNGLHAETGLRLPATLVFDYPTSAALANHILTGLVDDEPDAVATALATITKLENALL
TLETESRERTTITKRLERALSRYRDGGSATDQRDTHSDIRDASADELLDFFDQEFGKS
selected fasta
>polyketide synthase [polyketide synthase]
GTGGCGAACAACGAGGGAAAGCTGCTCGAGTACCTCAAGCGGACAACGGCTGAGCTTCGG
GATACCCGGGCGCGGTTGACCGAAACCGAGCGGAAAGAGTCCGAGCCGATCGCCATCGTA
GGAATGGCGTGCCGCTATCCCGGTGGGGTGTCCTCGCCGGAGGAACTCTGGGACGTGGTG
TCCGCCGGGACCGACGGTGTCTCGGAGTTCCCCGTCGACCGCGGCTGGGACGTGGACTCG
CTGTACCACCCCGACCCCGAGCACCTCGGCACCTCGTACACCCGGGAGGGCGGATTCCTC
CACGGGGCGGCGGAATTCGATCCGGGGTTCTTCGGCATATCCCCGCACGAGGCGGTGGCG
ATGGACCCACAGCAGCGGCTGCTGCTGGAGGTGTCCTGGGAAGCCATCGAACGTGCCGGA
ATCGACCCGACCTCGCTGCGGGGCAGCAAGACCGGCGTGTTCACCGGCGTGATGTACCAC
GACTACGGTTCCGGCGTCTCCGGCGTCTCCGAGGACATCGCGGCGTTCCAGGGCAACGGT
GCCGACTCCAGTGTCGTCTCGGGCCGCGTGGCCTACCTCTTCGGCCTGGAGGGCCAGGCG
GTGACGGTGGACACCGCCTGCTCCTCCTCCCTGGTGGCGCTGCACTGGGCGATTCAGGCC
CTGCGGGCCGGCGAATGCAGCATGGCGCTGGCCGGCGGGGTGACCGTGATGTTCACCCCG
GAGACCTTCATCGACTTCTCGCGGCAGCGCGGTCTCGCCGCGGACGGCCGCTGTAAGTCG
TTCGCGGCGGCCGCGGACGGCACCGGCTGGGGCGAGGGTGCCGGAGTGCTGCTGGTGGAG
CGGCTGTCCGACGCCCGGCGCAACGGGCATCCGGTCCTTGCCGTGGTGCGGGGCTCCGCG
GTCAACCAGGACGGTGCGAGCAGCGGGTTGACCGCGCCGAACGGCCCCGCGCAGCAGCGG
GTGATCCGGCAGGCGCTGGCCAACGCCCGGCTGTCCACGGGCGATGTGGACGCGGTGGAG
GCCCACGGCACCGGCACGCGGCTGGGTGACCCGATCGAGGCGCAGGCACTGCTGGCCACG
TACGGGCAGGACCGGCCGGAGGAGCAGCCGCTCTACCTGGGCTCGATCAAGTCGAACCTC
GGGCACACCCAGGCCGCCGCGGGTGTGGCCGGGGTGATGAAGATGGTGCTCGCCATGCGG
CACGGGATGCTGCCGAAGACCCTGCACGTGGACGAGCCCTCGCCGCATGTGGACTGGTCG
GCCGGCTCGGTGGAACTGCTCACCCAGGAACGCGAGTGGCCGGACTCCGGCCACCCCCGC
CGGGCGGGGGTGTCCTCCTTCGGGATCAGCGGCACCAACGCGCATGTCGTACTGGAGCAG
GCACCGGAGCCGGAGCCGGACGACGCGCAGCCGGCGGACCCGGAGGACGTACCGGCGACC
GCGGCGTCCGGGACCGGGCTCGTCCCCTGGGTGCTGTCCGCCCGCTCCCGGGAGGCGCTC
GCCGCGCAGGCCGGGCGCCTGGCGTCCCATGTGGCGTCCCGTCCCGAACTGGACCCGGTC
GACATCGGCTTCTCGCTGGTGACCACGCGCGCCGGACTGGACTATCGCGCGGCGGTGACC
GGCACCGGCCGCGAAGAACTGCTCGCCGGACTCCGGGCGCTGGCCGAGGACACGGAGCAG
CCGCGGGCCGTGAGCGAGGGACGGCTCGCCACGCTGTTCACCGGCCAGGGCGCACAGCGG
TTGGGCATGGGCCGCGAACTCCACGCGGCGTACCCGGTGTTCGCGCGGGCCTGGGACGAG
GTGTGCGCGGAGTTCGACGGTCTGCTGCCGCGCCCGCTGACCGAGGTCGTCTGGGCCGCA
CCCGGCGGCGGCGAGGAGGAACTCCTCCACCAGACGCAGTATGCGCAGGCGGCACTGTTC
GCGCTGGAGGTCGCCCTCTTCCGGCTCGTCGAGTCCTACGGCGTGGTCCCGGACGTGCTG
CTGGGCCACTCCATCGGTGAGGTCACCGCGGCCCATCTCGCGGGTGTCTGGTCGCTCGCG
GACGCGGCGAAGCTGGTCGCGGCCCGCGGGCGGCTGATGCAGGCCCTGCCGAGCGGCGGC
GTGATGGTGTCCGCGGCCGCCTCCGAGGACGAGGTGCGCGCGCTCCTGGAGGGCCGCGAG
CGGATCGGTATCGCAGCGGTGAACGGCCCGGCATCGGTGGTGATCTCCGGCGCCGCGGAG
CCGGTGGAGCAGGTGGTCGCGGTACTGGAGTCGCGCGGCCGGAAGGTGAAGGGGCTGCGG
GTCAGCCATGCCTTCCACTCGCCGCTGATGGACCCGATGCTGGCGGAGTTCCGCACGGTC
GTCGAGCAACTCACCTACTCCGAGCCACGGTTGCCGGTGGTCTCGAACGTGACCGGCCGT
CTCGCCGACCCCGCCGAACTCCGTGACCCGGAGTACTGGGTGCGGCACGTCCGGGAAGCC
GTCCGCTTCCACGACGGTATCCAGGCCGCCCACGCCGACGGCGTCACCACCTTCCTCGAA
CTCGGCCCCGGCGGCGTGCTCTCCGCCATGGGACGCGACTGCCTGCCCGAGGACGACACC
GTCACCTTCCAGCCGAGCCTGCGCACACCGCTCGCCGACCCCGAGGCACTGCTGAAGGCG
CTGACCGGGCTGTGGACCCGGGGCGTCCGCGTGGACTGCGCCGCCCTGCTGCCCGGTGGA
CGGCGGGTGGACCTGCCGACCTACGCCTTCCAGCGCGGCCGCTACTGGCTGGAGGGCGCC
GCCGGAGGCGCGGATGTGACCTCCGCCGGGCTCGGGGCGGGAAACCATCCGCTGCTCGGC
GCGGTGCTGCCGCTGCCCGGCTCCGACGGCTTCCTCCTGACCGGCCGGCTGTCCCTCGCC
ACCCACCCCTGGCTGGCCGACCATGTCGTCCTGGGCACCGTCGTGCTGCCCGGCTCCGCC
CTCGTCGAGCTGGCCGTCCAGGCCGGTGATCAGGCCGGCTGCACGCTGATCGACGAACTG
ACGGTGCTCGACCCGCTGGTTCTGCCCGCCCGCGGCGGCGTGCGGATCCAGCTCACCGTG
GACGCGCCGGACGAGCACGGCCGACGGGAACTTTCAGTGTTCTCGAAGCCCGAGGACGCC
GAGGACACCCGGCCCTGGACCCGGCACGCCACCGGTGTCCTCGCCGCCGGGGCCACCGCG
CCCGCGCCCGCCTTCCCGGAGACCGCCTGGCCCCCGGCCGACGCCGAACCCCTCATGGTG
GAGGGCCTCTACGACGAGCTGGCGGCGACCGGCTTCGGCTACGGGCCGGTCTTCCAGGGC
GTCCGCGCGGCCTGGCGGCGCGGCGAGGACCTGTACGCCGAGGTCGCCCTCCCCGACGAA
CCGGCCGCCCAGGCGGACACCTACGGGCTGCACCCCGCCCTGCTGGAAGCCGTGCTCCAG
ACCCTGAGCCGGGCCGAGTCCGCCGCCGACGGCCCCCGGCTGCCCGCCTCGTGGACCGGC
TTCCGGCTGCACGCCGTCGGCGCCACCACTCTGCGGGTCAAGATCTCCCCGGCCGGTGCG
GACGGCTTCTCCGTAGTGGCCGCCGACGCCGACAACGCCGTCGTCGCCTCCGTGGACCGG
GTCACCCGCCGCGCCGTGACCACCGACGAACTCGCCACCGACGCGAACCCCTCGGACTCG
CTGTACCGGCTGGACTGGACCCCCGTCCCGGTCGCCGAACGGACCGGCGGCTCCTGGGCG
GTGCTCGGCGACGATCCCGCCCTCGCCGCCGCCCTGGGCGCCTCCGTCCTCGACCCGGAC
GACACCGACGCCCCGGTACCGGACACCGTGGTGCTGCCGGTCATCGGGGCCACGTCCGGC
GCCGTGCCCGATGCCGTACGGGAAACCACCCATCAGCTGCTGGCCCGCCTCCAGTGGTGG
CTGGCCGAGGAGCGGTTCGCCGGCACCCGGCTCGTGGTGCTCACCCGCGGCGCGGTCTCG
GTGGCGGAGGAACCCGTCGACCTGGTGACGGCACCGGCCTGGGGCCTGGTGCACTCCACG
CAGTCGGAGCATCCCGACCGGCTCGTCCTCGTCGACATCGACGACGACACCCGGTCCCTG
GACGTGCTGCCCGCCGTGACCGACGCCGGTGAACCGGAGCTGGCGATCCGCGGCGGTCTC
GTCTCGGCACCCCGCCTCGCCCAACTGCTCGCTCCCGAGCGGGAACCGGAGCCGGTGTGG
ACGGCCGACGGCACGGTGCTGGTCACCGGCGGCACGGGCAGCCTGGGCGCGATCACCGCC
CGCCATCTCGTGGCCGACCTCGGCGTCCGGCATCTGCTGCTGACCAGCCGGCGCGGTATG
GCCGCCGAAGGCGCCGCGGAGCTGCGCGACGAGCTGACCGCACTCGGCGCCCGGGTGACC
ATCGCCGCCTGTGACACCGCCGACCGGGAGGCGCTGGCCGCCCTGCTGGCGACCGTCCCG
GCGGACGCCCCGCTAAGGGGGGTCGTGCACACCGCGGGTGTCCTGGACGACGGCGTCCTC
GCCTCGCTGAACCCGGAGCGCATGGACAAGGTGCTGCGGCCCAAGGTGGACGCGGCCTGG
AACCTCCACGAGCTGACCCGCGACCTCGACCTGTCCGCGTTCATCCTGTTCTCCGCCGCG
TGCAGCGTCTTCGACGCACCCGGACAGGCGAACTACGTGGCGGCCAACGCCTTCCTCGAC
GCCCTGGCCGAACACCGCCACGGCCTCGGTCTGCCGTGTGTCTCGCTGGCCTGGGGCCTG
TGGGCGCAGGACGGCGGCGGGATGGCCGGCGGCCTCGGTGAGAACGACCTGCGGCGGATG
GCCCGTAAGGGAATCGTGGCGCAGACCCCCGACGAGGGCATGCGGATGTTCGACGGCGCC
GTCCGCTCCGGCGCACCGCTGGTCGTGCCGGTCCGCCTGGACATCAACGTCCTCGCCGTC
ACCGGTGACTTCCCGCCGATGCTGCACGGCCTGGTCCCGTTCCGCCGGCGCACCGCCGCG
GCGGCCGGGGCCGGCACCGGCGACTCCCTGCGGGAACGGCTGGCCCCGCTGCCGCAGACC
GACCAGGACCGGGCCCTGATGGACCTGGTCACCGCCCAGATCGCCCTGGTCCTCGGATAC
GCCGGCGGCGGCGCGGTGGAAACCACCCGCGCCTTCCGGGACCTCGGCTTCGACTCCCTG
ACCGCGGTCGAACTGCGCAACCGTCTGGACACCGCGACCGGCCTGAGCCTCTCCGCGACC
CTGGTCTTCGACTACCCCACCCCCGTCGCCCTGGTCCGGCATCTGCGGGAACAGCTGCTG
GGCGCCTCGGCCGCGCCCGTCGCCGTGCGGTCCACCGCGCCGGCGACCGACGACGACCCC
ATCGTCATCGTCGGGATGGCCTGCCGGTTCCCCGGGCAGGTGGCCTCCCCCGAGGACCTG
TGGCACCTGCTGGTCTCCGGCGGCGACGCCATCAGCGCCTTCCCGGAGAACCGCGGCTGG
GACGTCGAGGGCATCTACGATCCGGACCCCGGCCGCAGCGGAAAGACCTACACCCGCGAA
GGCGGATTCCTCTACGACGTCGCCGATTTCGACGCGAGCTTCTTCGAGATCAATCCCCGC
GAGGCGCTGGCCACCGACCCCCAGCAGCGGATCCTGCTGGAGACCGTCTGGGAGGCCTTC
GAGAACGCGGGCATCGACCCGACCACCCTGCGCGGCAGCAAAACCGGCGTGTTCGCCGGA
GTGAGCTACCACGACTACGCCCCGCCGAGCGGCCAGATCCCCGAGGACCTCGAAGGGTAT
GTCGGGACCGGCAGCGCGGGCAGCGTCCTCTCCGGCCGGGTCTCCTACACCTTCGGATTC
GAAGGCCCCGCCGTGACCGTCGACACCGCCTGCTCCTCCTCGCTGGTCGCCCTGCACTGG
GCCATCCAGGCGTTGCGCACCGGGGAATGCACCCTGGCGCTGGCCGGAGGCGTATCGGTG
ATGTCCACTCCGGACACCTTCGTCGACTTCTCCCGGCAGCGCGGCCTGTCGGCGGACGGC
CGCTGCAAGGCCTTCGCCGCGGCGGCGGACGGCACCGGCTGGGGCGAGGGCGTCGGCATG
GTCCTGGTCGAGCGCCTTTCGGACGCCCGGCGCAACGGCCATACCGTCCTCGCGGTGGTC
CGGGGCACGGCGGTGAACCAGGACGGCGCCTCCAACGGCCTCACCGCACCGAACGGCCCC
TCGCAGCAGCGCGTCATCGAACAGGCCCTGGCCAACGCGGGAGTGACGGCCGATCAGGTC
GACGCGGTGGAGGCCCACGGCACCGGCACCACCCTGGGCGACCCCATCGAGGCCCAGGCG
CTGATAGCCACGTACGGCCGGGAACGGATTGCCGACCGACCCCTGTTGCTGGGGTCGATC
AAGTCCAACATCGGGCACACCCAGGCCGCCGCCGGTATGGCCGGGGTGATGAAGATGGTG
CTGGCCATGCGGCACGGCCTGTTGCCGAAGACCCTGCATGTCGATGAGCCCACCCCGCAC
GTCGACTGGTCCGCCGGCACCGTCGAGCTGCTGACCGAACTCCGGCAGTGGCCGAAGACC
GGTGAACCCTGGCGGGCCGGTGTGTCCTCGTTCGGCATCAGCGGGACGAACGCGCATGTG
GTGCTGGAGCAGGCGCCGGTGGCTGAGCCGGTGGCCGTGGAACCGGACACGACCGGGCCT
GCCGGGGGCGCGTCTGCCGGCCTGGTGCCGTGGGTGCTGTCGGCGCGTTCGGAGCAGGCG
TTGGTCGCGCAGGCAGACCGGCTGGCGTCCTTTGTGGAGGAGCGCCCGGAGCTGTCCGTG
GCCGATGTCGGCTTCTCGCTGGTGGCTTCGCGGGCGGAGTTGGAGCACCGGGCCGTGGTG
GTCGGCGCCGATCAGGATCAGTTGCTGAGCGGTTTGCGTGGGCTCGCCGGTGGGTTTGCC
GGTGGCCTGGATGGTGCCGGTGTGGTCCAGGGCAGTGTGGCGGCTACGGCAGCTTCTGGT
GCGGTGCTGGTGTTCCCTGGTCAGGGTTCGCAGTGGCTGGGTATGGCGGATGAACTGCTG
GCTGCGTCGCCGGTGTTCGCGGGGCGGATGGCTGAGTGTGGTGCGGCGCTGTCGGAGTTC
GTGTCCTGGAAGTTGGATGAGGTTCTGTCCGACGAGGACATGCTGACGCGCGTTGATGTG
GTGCAGCCGGTGCTGTGGGCGGTGATGGTGTCGTTGGCCGCGGTCTGGGAGGACTGCGGC
GTGGTGCCCGCTGCCGTGGTGGGGCACTCCCAGGGCGAGATTGCCGCGGCCTGCGTCGCC
GGGATCTTGTCCCTGCGTGATGGCGCCCGGGTGGTGGCGTTGCGCAGCCAGGCCATCGGC
CGAGTGTTGGCCGGACGCGGCGGTATGGTCTCCGTCGCCGGCTCCCGCGAGGCAGTCCAG
GAGCGCATTGCCAAGTGGGGTGAGCAGCTCTCCGTGGCCGCCCTCAACGGGCCGTCCGCC
ACGGTCGTTTCGGGCGACCCCGATGCCTTGCAGGAGTTGCTGGCGGAGTGCGCCGAGCAG
GACGTACGGGCCCGGAAGATTCCGGTGGACTACGCCTCGCACGGCGCGCAGGTCGAGTTG
CTGCGCGAGGAGCTGGCGACCGTGCTGGCCGAGGTGCGCCCCGGTCAGGGCCGTATCCCG
TTCTATTCGGCGGTGCATGCTTCGCTCATATCGGGCGAGGAGCTGGATGCTGCGTACTGG
TTCGAGAACCTGCGCAACACCGTGCGGTTCGAGGAAGCGATCCAGGCCCTCCTTGCGGAC
GGGCACGGCGTCTTCGTCGAATGCAGCGCGCACCCCGTACTGACGCCCGGCATCGAGGAC
ACGGCACAGGAAGCGAGCAGCCCCGTCGTGGTGACGGGCACCCTGCGCCGCGACGAAGGC
GGCTGGTCCCGGTTCGCGCAATCGCTGGGCCAGCTCTGGGCGCACGGCGTCCCGGTGGAC
TGGAGCACCCTGCTCCCGGCCGGTCGGCGGGTCGACCTGCCCACCTATGCCTTCCAGCGA
CAGCGCTACTGGCTGGAGACCTCGTCCGGCGCCGGGGATGTGTCCTCGGTGGGGCTGGGC
GCGGCGGACCATCCGCTGCTCGGTGCCGCGGTGGCGCTGCCGGACTCGGACGGCTTCTTG
TTCACGGGACGGCTGTCGCTGGCCACGCACCGTTGGCTGGCCGATCACAGCGTGCTGGAC
ACGGTGCTGGTGCCGGGCACCGGGCTGGTCGAACTGGCCATCCGTGCCGGGGACCAGGTG
GGTTGCGATCTGCTGGAGGAACTCACTCTGGAGAGTCCGCTGATCATCGCGCCGACCGGT
GGGGTGCAGCTGCGGGTCACCGTCGGTGAGCCCGACGAGAACGGGCGCCGGAACCTCGCG
GTGTTCTCCCGTGACGAGGACGCAGCGGCCGGCCAGCCGTGGACCCGGCATGCCACCGGC
ACTCTGGCCGTCGGCACCGGCACGCCGGCCGCGCGCGGCGAGGAGTCCTGGCCGCCTGCC
GGTGCGGAAGCCGTTCCGGTGGACGGGTTCTACGGGGGGCTCGCCGAGGCGGGCTACGAG
TACGGCCCGGTGTTCCAGGGGCTGCGAGCGGCGTGGCGGCGCGGGGAGGACATCTTCGCG
GAGGTCGCCCTGCCCGAGGAGGCCGTCGGAGAGGCGGGCCGATTTGGTCTGCATCCGGCA
CTCCTCGACGCCGTGCTGCACACGGTGGGCCTGGGCGAAGCCCACGGCGACGAGGGGCCG
GGGCTGCCGTTCGCATGGACCGGGGTCCAGCTGCATGCGGTGGGCGCCACCGCGCTGCGC
GCCAGGCTGAGCAAGGCCGGCGAGAGCGGTGTGCGGGTCGAGGTGAGCGATGCCACCGGG
GTTCCCGTGGCGACCGTCGAGTCGCTGGTGATGCGTGAGGTCTCGGCCGACCAGCTGCGG
GCGGCCGGCAGCGGCCGGGACGCGGTCTTCCGGCTGGACTGGACGGAGCTGCCCGGCCTC
ACCGGCCGAGTCATCGAGACGTCCATGGCCGTGGTCGGGCCCGCGGCCGACGAGTTCGCC
GGCTCCTTGCGTGCCGCCGGTATCGAGGCCGGCACCGCGGCGGATCTGGTGGTGCTCGGC
AAGCAGGACACGGTGCCGGAGTACGTGCTGCTGCCGGTCCCGGCGGCCGGCGCGGGTGCG
GTGCCGGATGCCGTGCGCTCGGCGGTGCACCAGGTGCTGGGGACGGTGCAGAGCTGGCTG
GCCGAGAGCCGGTTCGCCGATGCGAAACTGGTGGTTCTCACCCAAGGCGCGGTCGCCGCG
TCCGGTGAGAGCCCGGATCTCGCGCTCGCCCCCGTCTGGGGTCTGGTGCGCTCCGCGCAG
TCCGAGAACCCGGGCCGGATCGTGCTCGCCGACGTCGACGGCGAGGTGTCGTCGCTGCGG
GCCCTGCCCGGACTGCTGGCCGAGGCGGAACCGCAACTGGCGGTGCGTGGCGGGGTCGCC
GCCGCTCCCCGGCTGGCCCGGTTCGGGCCGGTGGACACCGACCGGGAACCCGTATGGGCC
GGTCACGGCACGGTGCTGATCACCGGTGGCACCGGCATGCTGGCCGGTCTGGTCGCTCGG
CACCTGGTCGCCGAGCACGGTGCGAAGCGGCTGATTCTGGCCGGCCGTCGGGGCCTGGCA
GCCGACGGAGCCGCGCGCCTCCGGGACGAGCTGACCGCGCTCGGTGCCCACGTGGAGGTG
GTCGCCTGTGACGCGGCCGACCGCGACGCGCTGGGCGCACTGCTCGCCGGGATACCGGCG
GACGCGCCGCTGACCGGTGTGGTGCACACCGCCGGGGTGCTGGACGACGGACTGATCGGC
GCGCTGACCCCGGAGCGGATCGAGACCGTACTGCGGCCCAAGGTCGACGCGGCCTGGAAT
CTGCACGAACTCACCAAGGAACGGGACCTGTCGGCGTTTGTGCTGTTCTCCTCGGCCTCC
GGGGTGCTCGGCGCACCCGGACAGGCAAACTACGCGGCGGCGAGCACCTTCCTCGACGCG
CTGGCCGAGCACCGGCACGCCCACGGCCTCCCCGCGCTGTCACTGGCCTGGGGGCTCTGG
TCGGAGCGCAGCGACCTCACCAGGAAGCTCACCGAGACCGATCTGCGGCGGATGAACCGG
GAGGGGCTGCCGCCGATGTCCTCGGAGGAGGGCGTGGCGCTCTTCGACGTGGTGGGCGCC
GCCGAAACCCCGGTGGTGATCCCTGTCGCGCTGGACGCCAAGAAGGTGGCGGCGGCCGGG
GAGGTGCCCGCGGTCCTGCGCGGCCTCGTCCGTGCTCCCGCACGCCGTACGGTGAGTGCC
GGGCCCGCCTCGGCGAAGTCCCTGCGCGACCGGCTGGCGGAGGTGCCGCCCGCCGAACGT
GCCGCCGTGGTGCTGGAGTTGGTGCGCAACCACACGGCCATGGTGCTGGGGCACTCCGGT
GCCGACATGGTCAACGCGGATCAGAGCTTCAGCGAGCTGGGCTTCGATTCACTGACCGCG
GTGGAGCTGCGCAACGGCCTCCATGCGGAGACCGGGCTGCGGCTGCCGGCCACGTTGGTG
TTCGACTACCCGACCTCCGCGGCACTGGCGAACCACATTCTCACCGGCCTCGTCGATGAC
GAACCCGATGCGGTCGCCACGGCGCTGGCGACCATCACCAAGCTGGAAAACGCTCTTTTG
ACGCTGGAAACGGAAAGCCGTGAACGAACGACCATCACGAAACGCCTTGAGCGGGCCTTG
AGCAGGTATCGCGACGGCGGCTCGGCAACGGATCAACGCGATACCCACAGCGATATCCGG
GATGCCTCCGCCGATGAACTACTGGACTTCTTCGACCAGGAGTTCGGAAAGTCCTGA
[2] KS35..411
[2] AT572..890
[2] malonyl-CoA763..767
[2] dh936..1101
[2] KR1404..1584
[2] ACP1686..1756
[3] KS1779..2155
[3] AT2322..2638
[3] methylmalonyl-CoA2511..2515
[3] DH2684..2848
[3] KR3163..3343
[3] ACP3444..3514
[2] KS103..1233
[2] AT1714..2670
[2] malonyl-CoA2287..2301
[2] dh2806..3303
[2] KR4210..4752
[2] ACP5056..5268
[3] KS5335..6465
[3] AT6964..7914
[3] methylmalonyl-CoA7531..7545
[3] DH8050..8544
[3] KR9487..10029
[3] ACP10330..10542

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [763-880]  4.4e-76 G3DSA:3.40.366.10 [2510-2627]  2.5e-65 G3DSA:3.40.366.10
G3DSA:3.40.366.10   no description
IPR006162 Phosphopantetheine attachment site (PTM)
 [1714-1729]  PS00012 [3472-3487]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1690-1755]  8.7e-10 PF00550 [3449-3513]  2.1e-11 PF00550
PF00550   PP-binding
 [1685-1759]  1.6e-18 G3DSA:1.10.1200.10 [3444-3515]  1.2e-19 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   no description
 [1686-1756]  19.819 PS50075 [3444-3514]  21.484 PS50075
PS50075   ACP_DOMAIN
 [1679-1795]  1.8e-25 SSF47336 [3436-3531]  1.4e-22 SSF47336
SSF47336   ACP-like
IPR013968 Polyketide synthase, KR (Domain)
 [1404-1583]  1.9e-61 PF08659 [3163-3342]  1.9e-64 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [35-285]  1.5e-97 PF00109 [1779-2029]  1.2e-98 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [293-411]  1.3e-48 PF02801 [2037-2155]  1.3e-47 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [572-890]  8.1e-58 PF00698 [2322-2638]  7.8e-96 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [3-28]  1.6e-09 PF08990
PF08990   Docking
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [568-881]  2.6e-72 SSF52151 [2320-2610]  1.1e-59 SSF52151
SSF52151   FabD/lysophospholipase-like
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [698-762]  7.7e-16 SSF55048 [2445-2510]  1.2e-18 SSF55048
SSF55048   Probable ACP-binding domain of malonyl-CoA ACP transacylase
IPR016038 Thiolase-like, subgroup (Domain)
 [37-297]  1.1e-89 G3DSA:3.40.47.10 [298-464]  3.5e-66 G3DSA:3.40.47.10 [1779-2040]  1.7e-89 G3DSA:3.40.47.10 [2041-2207]  3.3e-64 G3DSA:3.40.47.10
G3DSA:3.40.47.10   no description
IPR016039 Thiolase-like (Domain)
 [27-463]  1.8e-107 SSF53901 [1771-2153]  1.7e-102 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1402-1588]  7.2e-36 G3DSA:3.40.50.720 [3164-3342]  6.4e-33 G3DSA:3.40.50.720
G3DSA:3.40.50.720   no description
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [198-214]  PS00606 [1942-1958]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [572-871]  6.7e-124 SM00827 [2324-2619]  2.5e-110 SM00827
SM00827   Acyl transferase domain in polyketide syntha
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1687-1759]  1.3e-29 SM00823 [3445-3517]  4.9e-31 SM00823
SM00823   Phosphopantetheine attachment site
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [936-1101]  6.8e-85 SM00826 [2684-2848]  1.1e-84 SM00826
SM00826   no description
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [37-463]  1.2e-229 SM00825 [1781-2207]  1.7e-226 SM00825
SM00825   Beta-ketoacyl synthase
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1404-1584]  5.1e-57 SM00822 [3163-3343]  1.4e-62 SM00822
SM00822   no description
SignalP No significant hit
TMHMM No significant hit