close all open/close all

CDS information : Lydi_00110


close this sectionLocation

Organism
StrainTP-A0598 (=NBRC 110027)
Entry nameLydicamycin
Contig
Start / Stop / Direction23,077 / 44,241 / + [in whole cluster]
23,077 / 44,241 / + [in contig]
Location23077..44241 [in whole cluster]
23077..44241 [in contig]
TypeCDS
Length21,165 bp (7,054 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)polyketide synthase
GeneTPA0598_03_00750
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[26380643] Draft genome sequence of marine-derived Streptomyces sp. TP-A0598, a producer of anti-MRSA antibiotic lydicamycins. (Stand Genomic Sci. , 2015)

close this sectionPKS/NRPS Module

4 malonyl-CoA
5 malonyl-CoA
6 methylmalonyl-CoA
7 malonyl-CoA
KS33..409
AT562..876
dh924..1086
KR1380..1560
ACP1660..1730
KS1751..2128
AT2281..2591
DH2639..2802
KR3109..3289
ACP3390..3460
KS3482..3859
AT4019..4336
dh4381..4544
KR4846..5026
ACP5126..5196
KS5219..5595
AT5778..6094
DH6141..6303
KR6618..6798
ACP6900..6970

close this sectionSequence

selected fasta
>polyketide synthase [polyketide synthase]
MQVTNNEKLVEYLKQAAIDLRESRRRVWELESEPIAIVGMACRYPGGVSSPEDLWDLVSQ
GENGITEFPADRGWDIDSLYNPDPASRGTSYVRQGGFLHEAAEFDPAFFGISPREALAMD
PQQRLMLEVSWEAIERAGIDPLSLKGSKTGVFAGVMYHDYGTGVSGISEEVAAFLGSGSD
GSIFSGRVAYLLGLEGPAVSVDTACSSSLVSLHLAIQALRSGECSMALAGGVTVMSTPVT
FVDFSRQQNLARSGEVKAFGTGADGTVLSEGAGILLVERLSDAERNGHPILAVVRGSAVN
QDGASNGLTAPNGPSQQRVIDQALANAGVTASQVDAVEAHGTGTTLGDPIEAQALLATYG
QDRPEDRPLWLGTVKSNIGHSQAAAGAAGVIKMVMALRHGVLPKSLHIDAPSSHVDWSAG
AVELLTEARPWPESDQPRRAGVSSFGISGTNAHVVLEQAPEEERVESVAPAVVEPGPGPV
PWVLSARSPQALVGQAERLGAFVARQPELGLADVGFSLATSRAGLEYRAVVTGSDRESLL
GALGALPSVSGPVAGEGRLGVLFTGQGAQRLGMGRELYETYPVFARAWDEVCAELDGLLP
RPLTEVVWGGGDLLDQTQYAQAALFALEVALYRWVESRGVAPAVLLGHSIGEVTAAYLAG
VWSLADAAKLVAARGRLMQALPAGGVMVSVRASEGEVAPLLEGREQVGIAAVNGPESVVV
SGAEAEVEQIAAVLEAEGRKVKRLRVSHAFHSPLMDPMLADFRTVLDQLTYDEVKLPVVS
NVTGRLAEPAELRDPEYWVRHVREAVRFHDGMRAAYDEGVTTFLELGPDGVLAAMGQDCL
REVEGTPAAFLPGLRKDRSEPEAVLQALGAAHARGVVVDWATFFPGARQVALPTYAFQRQ
RYWLDRTGAGTGDMTSAGLGAADHPLLSAAVALPDSDGFLFTGRLSLATHPWLADHAVLG
TAVLPGSALVELAIRAGDQVGCDLLEELTVRAPLILPERGGVQLRVALGQSAVDGRREIA
VFARDEEAVDEAWTRHADGVLAAGAPVGSIDAPVWPPVGAEAVSVEGLYGELAAAGFEHG
PVFGGVRAMWRRGDEVFAEVALPEEIADRAGEFGLHPALLDAALQPVTGGLRLPVSWSGV
RLHAVGAVSLRVQLTKARDGYALTATDEAGGLVASADGVTWGAVSAEEFANAGVRHRDSL
FGVEWSELPLRSEPVAGSWAVLGEDAGLAAALGADVLSELVDVPEHVVLAVPGTDGALEV
PAAVRATVGRVLESVQSWLADERCTRSKLVVATRGAVSVAGEPLDAVGGAVWGLLRSAQA
ENPGQFVLLDLDEQQSSVEAVAAAVASGEPQLAVRDGVVSVPRLVRTTPSDNAPVWGSEG
TVLITGGTGTLGALFARHLVSEHGVRSLVLTSRRGLEANGAQELQSELTELGARVEVVAC
DAADREALGELLASIPADAPLTGVVHTAGVLDDGIIGSLTPERLDTVLRPKVDAAWNLHE
LTQGLDLSAFVLFSSAAGVLGSAGQGNYAAANSFLDALVEHRRLSGLPGTSLAWGLWADA
SGMTGQLSETDLRRMAADGVLPVSAAEGVDLFDAAIAVESALSVPIHLDVRALAAAPSVP
AILHGLVPVRRRTAAAGGGAGSTLRDRLVVLTKAEQDRALLDLVTAQVALVLGYSDSSGL
DASRAFKDLGFDSLTAVELRNRMDNATGLRLPATLIFDYPTPSAMVRHLREELLGGQTAT
PAVRAKAAVDDEPIAIVGMACRFPGGIDSPEALWELLARGGDAIGDFPADRGWDVERLYH
PDPEHKGTSYVREGGFLGNAGDFDAGFFGVSPREATAMDPQQRILLETSWETLENAGIDP
TTLRGSDAGVFVGTNGQDYGSVLAQGTDNADGYLITGTSASVVSGRVSYSLGFEGPAVTV
DTACSASLVALHWAMQALRSGECSLALAGGVSVMSTPDTFVDFSRQRGLAADGRCKPFAA
AADGTGWGEGVGMLLVERLSDARRNGHTVLAVVRGSAVNQDGASNGLTAPNGPSQQRVIR
QALAGAGLEPSEVDAVEAHGTGTRLGDPIEAQALLATYGQGRPADQPLWLGAIKSNLGHT
QAAAGVAGVMKMVLAMRQGLLPKTLHLDEPTPHVDWSAGAVELLAEAQEWPDTGRPRRAG
VSSFGISGTNAHVVLEQAPEEERVESAAPAVVEPGPGPVPWVLSARSPQALVGQAERLGA
FVARQPELGLADVGFSLATSRAGLEYRAVVTGWDRESLLGALGALPSVSGPVAGEGRLGV
LFTGQGAQRLGMGRELYETYPVFARAWDEVCAELDGLLPRPLTEVVWGEDDLLDQTQYAQ
AALFALEVALYRLVESRGVTPAVLLGHSIGEVTAAYLAGVWSLADAATLVAARGRLMQAL
PAGGVMVSVRASEDEVAPLLEGREQVGIAAVNGPESVVISGAEAEVEQIAAALEREGRKA
KRLRVSHAFHSPLMDPMLADFRTVLDQLTYNDARLPLISNVTGEPADSAELRNPEYWVRH
VREAVRFHDGIQAAQSEGVTTFLELGPDGVLCAMGQDCLPETVTLQPSLRKKRSEPEAVL
QALGAVYARGVVVDWATFFPGARQVALPTYAFQRQRYWLDRTGAGTGDMTSAGLAAADHP
LLSAAVPLPGSDGFLFTGRLSLATHPWLADHAVMDTVLVPGTALVELAIRAGDQVGCDLL
EELTLQAPMIIPSAAGIQIQITVDGPDAHGRRELSMFSRGEDGAEPWTQHALGVLTTAGA
TPVLDLGEAAWPPAGAEAVSVDGFYAELVDAGFGYGPVFQGVRAAWRRGAELFVEVALPE
GAAEQAAEFGLHPALLDAVLQTFGLSDDLGTDGPGLPFAWAGVRLHAVGAASLRARLTPT
GDGGMRILAVDDAGAPVATIDALTTRPVPAAGQLASAGGGRREELFAVEWAPVALPAGDV
DGSWAVADEDVVLAAGLGVAVLDPSAESVPGHVAWSPAVETGASAVVPGSVRGATAEVLQ
RVQVWLADERCDGSTLVVVTRGAVSMASEPVEVAAAAVWGLVRSAQSENPGRLVLVDVDG
EANSLQAVRAAVASGEPQLAIRNGVVSVPRLARTVPSGVDGARVWDPEGTVLITGGTGNL
GALFARHLVSEHGVHSLVLTSRRGLEAVGARELQSELTELGARVEVVACDAADRDALAAV
LASIPSDVPLTGVVHTAGVLDDGIIGSLTPERLDTVLRPKVDAAWNLHELTQGMDLSAFV
LFSSAAGVLGSAGQGNYAAANSFLDALAEHRRLSGLPGTSLAWGPWAADTSGMTGQVEDT
HLRRMAADGFLAISAADGTAMFDAAVGAEEAVIAPIRLDARALAASGAVPAILRGVVRVP
ARRTAAEATSAGSLGDRLLGLPVEERDELLLDLVTTQVAAVLGYENSGAVRIDQVFKDLG
FDSLTAVELRNRLNSATGLRLPATLVFDYPTPAALLDHLRDELVGDRDQPAVTSVATSTT
VDEPIAIIGMACHLPGNVHSPEDLWRMLETGRDGISAFPGDRGWNLDALYHPDPDHHGTS
YTREGGFLDGAADFDPTFFGISPNEALAMDPQQRLLLETSWEALESAGIDPTTLRGTPTG
VYAGLMYHDYVNQLQSVGEGVEGFMGTGNSGSVTSGRLAYSFGFEGPAVTVDTACSSSLV
ALHFAVQALRSGECSLALAGGVTVMATPDTFIDFSRQRGLSADGRCKPFAAAADGTGWGE
GVGMLLVERLSDARRNGHRVLAVVRGSAVNQDGASNGLTAPNGPSQQRVIRQALAGARLS
PSEVDAVEAHGTGTRLGDPIEAQALLATYGQDRPEDRPLWLGSIKSNIGHTQAAAGVAGV
MKMILAMQQGILPKSLHVDEPSPHVDWAAGAVELLAEAREWPDTGRPRRAGVSSFGISGT
NAHVVLEQAPEDVPAEPVEESRPGALPWVLSARSEQALAAQAGRLVSFVEQRPEVGPADV
GFSLLSTRAELEHRAVVVGADQDQLLSGLRGLAGGFAGGLDGAGVVQGSVAATAASGAVL
VFPGQGSQWLGMADELLATSPVFAGRMAECGAALSEFVSWDLMAVLSDEDALARVDVVQP
VLWAVMVSLAAVWEDCGVVPSAVVGHSQGEIAAACVAGILSLRDGARVVALRSQAIGHVL
AGRGGMVSVAGSREAVQERIARWGERLSVAAINGPSATVVSGEPDALQELLAECAEQEVR
ARQIPVDYASHGAQVEELREELATVLAEVAPAEGRIPFYSAVHASAVSGEELDAAYWFEN
LRNPVRFEEAVQALLSDGHGVFVECSAHPVLTPGIEDTAQRAGSPVVVTGTLRREEGGWS
RFAQSLGQLWAHGVQVDWSTLVPAGRRVDLPTYAFQHKRYWPATVVAAGDATGLGQADSQ
HPLLGAAVALPESDGYLLTARLSLATHPWLADHSVLGAVVLPSSALVELAIRAGDQVGCD
LLEELTVLVPPVLSEGAGLQLRVTVGESDADGRRELAVFSRNEDAEADLPWTRHATGLLA
AGAAPVGFGEAVWPPAGADTLTVDGLYDELAAAGITHGPVFENVRAAWRRGADLFAEVAL
TEENAGEAGRFGLHPALLDAALQPVTRQEAADGTQLATQWTGVTLFADGATALRVKLSSV
GDGYALVVADHDGEVVAAAESIAWTAISEAEVAVAGPGHRDSLFGVEWSELPLRSEPVAG
SWAVLGEDVGLAAVLGASGADVLSELVEVPECVVLAVPGVDGALEVPAAVRAAVGRVLEG
VQSWLADERCTRSKLVVATRGAVSVAGEPLDAVGGAVWGLLRSAQTENPDQFVLIDLDEC
ESSVEAIAAAVASGESQLAVRDGVVSVPRLVRTTPSDSAPVWGSEGTVLITGGTGTLGAL
FARHLVSEHAVRSLVLTSRRGLEANGAQELQSELTELGARVEVVACDAADRDALAAVLAS
IPADAPLTGVVHTAGVLDDGIIGSLTPERLDTVLRPKVDAAWNLHELTQGMDLSAFVLFS
SAAGVLGSAGQGSYAAANTFLDALAEHRRLSGLPGTSLAWGLWADASGMTGQLSETDLRR
MARGGMIPLGQAEGTALFDAAMATDQPVALSAHLDLNTIAATGEVPSLLRSLVRVRRRAV
TTGSATADTLAERLRPMTEAERERTLVELVRRQASAVLGYDGGDAVGTTRAFKELGFDSL
TAVELRNRLNAATGLTLPATLIFDYPNPEALARYVREELLGTVAAPVATVPVARPVDDDP
IVIVGMACRYPGGVASPDDLWQLVTSGGDAISGFPVNRGWDLDNLFGSDSAETGKSITQQ
GGFLYDAGEFDAGFFGISPREALAADPQQRILLEAAWETFENAGIDPLALNGSQTGVFTG
INYHDYAPADGNVPEDIEGYLTTGGAGSVLSGRISYSLGLEGPAVTVDTACSSSLVALHL
AIQALRTGECSMALAGGVCVMATPGNFVEFSRQRGLAADGRCKPFAGAADGTGWAEGAGM
VLVERLSDARRNGHPILAVVRGSAVNQDGASNGLTAPNGPSQQRVIRQALANAGLEPSDV
DAVEAHGTGTTLGDPIEAQALLATYGQNRPADQPLWLGAVKSNIGHTQAAAGAAGVIKMV
FALQQGLLPKTLHVDEPTPHVDWTAGAVELLTETRKWPETGRPRRTGISAFGISGTNAHV
ILEQAPVEELATTEATKTGLAKTELAKTELAKTELAKAEPGEAASAASGPADALSWILSA
RTQEALYAQAARLVAFATEHPELAPAEIGFSLATTRAALEHRAVVAGADRDALLAAAGRL
AAGEHPTAVAGDGRVGVLFTGQGAQRLGMGRELYDAYPVFARAWDEVCAELDGLLPRPLR
EAVWGEDDLLDQTQYAQAALFALEVALYRLVESHGVTPDVLLGHSIGEVTAAYLAGVWSL
ADAAKLVAARGRLMQALPAGGVMASVRASEDEVAPLLEGREQVGIAAVNGPESLVVSGAE
AEVEQIVAALESQGRKVKRLRVSHAFHSPLMDPMLADFRTVLEQLTYNEAELALISNVTG
RLADPAELRDPEYWVRHVREAVRFHDGIQAAHAEGVTTFLELGPDGVLSAMGQDCLPQTA
TTTAPVTLQPTLRKDRPEPGALMDALGGLWARGVAVDWAPLFPGARRVALPTYAFQRQNY
WLPANAGSGNVSSIGLGAADHPLLGAAVSLPDAVVLTGRLSLATHPWLADHTIMDTVLLP
GTALVELAIQAGDQVGCDLLDELTLHAPLILPPHGGMQLRVTVGEESAGDGRRELAVYSR
NENEPELEWTRNATGTLTVAADTPERFSETVWPPADAEPIPVDGFYEELVSVGFAYGPVF
QGLRAAWRRGAEVYAEVALPEEPGADAAKFALHPALLDAALQTVGLLGDAVSGLPFAWTG
VRLHAVGATALRVRLAPAGDGGVQVLVADETGAPVATIDSLVTRPVPAEQLGSSTRRGAL
YELAWTVLEEEAAEPVSGSWTLVGPDAEKIAETLRRAGEDVSTCPEPANAAGQDVAPDFV
VLPVAVPASGAGTEATPTATRAAVHRVLGTVQTWLADERLADTRLIVLTRGAVSPDGAPA
DLVSTPVWGLLRSAQSEHPGRIVLADLDDEDTSMARLPALIAAGEPQAAIRRGVLSVPRL
AVLEPSGQDSVPVWNTGGTVLITGGTGVLGAEVARHLVTGHGVRNLVLTSRSGPTAEGAE
ELRAQLTEAGARVEILACDAADRDALAAVLAGIPADAPLTGVVHTAGVTDDGVITSLTPD
RVDRVLRPKVDAAWNLHELTQDLDLSAFVLFSSVAGILGAPGQGNYAAANTFLDALAAHR
RAAGLPAVSLPWGLWARSSGMTGKLGEADLRRIGSGGLVPLSSEAGVALLDAATVAGPAV
VLPMDLDPRKLAASGDIPAVLRGVVRAPARRAAAAGPVVAEVSLGDRLGAVPAAERSGMV
LDLVRTHVAAVLGHAETGKMKADQQFTELGFDSLTAVELRNRLHTATGLRLPATLIFDYP
TSAALADHILGEVVANEPDPVATVLATIEKLEAGLSMLRTESGDRRDITKRLERALSQYR
DGDAAEYGDDTDSDIRDASTDELLDVFDREFGNS
selected fasta
>polyketide synthase [polyketide synthase]
GTGCAGGTGACGAACAACGAGAAGCTTGTCGAGTATCTGAAGCAGGCGGCGATCGACCTG
CGAGAGAGCCGCCGTCGCGTCTGGGAGCTCGAATCCGAGCCGATCGCGATCGTCGGAATG
GCCTGCCGGTACCCGGGCGGGGTGTCGTCACCGGAGGATCTCTGGGACCTGGTGTCCCAG
GGCGAGAACGGCATCACCGAATTCCCCGCCGACCGTGGCTGGGACATCGACTCGCTGTAC
AACCCGGACCCCGCAAGCCGCGGTACTTCCTACGTCCGGCAGGGCGGATTCCTGCACGAG
GCCGCGGAGTTCGACCCGGCATTCTTCGGCATCTCACCGCGCGAAGCGCTGGCCATGGAC
CCACAGCAGCGGCTGATGCTGGAGGTCTCCTGGGAAGCCATCGAACGCGCCGGAATCGAT
CCCCTTTCGCTGAAGGGGAGCAAAACCGGTGTGTTCGCCGGCGTCATGTACCACGACTAC
GGCACCGGAGTCTCCGGCATATCGGAGGAAGTGGCCGCCTTTCTGGGCAGCGGTTCCGAC
GGCAGTATTTTCTCCGGCCGGGTGGCCTATCTGCTCGGCCTCGAAGGCCCGGCCGTGTCC
GTGGACACCGCCTGTTCTTCCTCGCTGGTCTCCCTGCACCTCGCGATCCAGGCGCTGCGC
TCCGGCGAATGCTCGATGGCGCTGGCCGGCGGCGTCACCGTGATGTCCACCCCGGTCACC
TTCGTCGACTTCAGCCGCCAGCAGAACCTGGCACGCAGCGGTGAGGTCAAGGCGTTCGGC
ACGGGCGCCGACGGCACCGTGCTCTCCGAAGGCGCCGGAATCCTGCTGGTCGAGCGGCTG
TCGGACGCCGAGCGCAACGGTCACCCGATCCTGGCGGTGGTGCGGGGTTCGGCGGTGAAC
CAGGACGGTGCGTCCAACGGACTGACCGCGCCCAACGGCCCCTCGCAGCAGCGCGTCATC
GACCAGGCACTCGCCAACGCCGGCGTGACCGCGAGCCAGGTCGACGCGGTGGAGGCGCAC
GGCACGGGAACGACGCTGGGCGACCCGATCGAGGCCCAGGCGCTGCTGGCCACATACGGC
CAGGACCGCCCGGAGGACCGGCCGCTGTGGCTGGGTACGGTCAAGTCGAACATCGGACAC
AGCCAGGCCGCGGCAGGCGCGGCCGGTGTCATCAAGATGGTCATGGCCCTGCGGCACGGT
GTGCTGCCCAAGAGCCTGCACATCGACGCGCCCTCGTCACACGTGGACTGGTCCGCCGGC
GCGGTGGAGCTGCTGACCGAGGCCAGGCCATGGCCCGAGAGCGACCAACCGCGTCGGGCA
GGCGTCTCGTCGTTCGGTATCAGCGGGACGAATGCGCATGTGGTGCTGGAGCAGGCTCCT
GAAGAGGAGCGGGTGGAGTCGGTTGCTCCGGCGGTGGTGGAGCCGGGGCCGGGGCCGGTG
CCGTGGGTGTTGTCTGCTCGTTCTCCGCAGGCGTTGGTGGGGCAGGCGGAGCGTCTTGGG
GCGTTTGTGGCGCGGCAGCCGGAGTTGGGGCTTGCTGATGTCGGGTTCTCGCTTGCGACG
AGCCGTGCGGGGTTGGAATACCGTGCCGTGGTCACGGGTTCGGACCGCGAGTCGCTGCTT
GGTGCTTTGGGGGCACTGCCTTCGGTGAGTGGGCCGGTGGCTGGTGAGGGACGGCTTGGT
GTGCTGTTCACCGGCCAGGGCGCGCAGCGGCTGGGGATGGGCCGTGAGTTGTATGAGACC
TATCCGGTGTTCGCGCGGGCCTGGGATGAGGTGTGTGCGGAGCTGGACGGTCTGCTGCCT
CGGCCGCTGACGGAGGTGGTCTGGGGCGGGGGTGATCTGCTCGATCAGACGCAGTATGCG
CAGGCGGCGCTGTTCGCGCTGGAGGTGGCGCTGTATCGGTGGGTGGAGTCGCGTGGTGTG
GCTCCGGCTGTGTTGCTGGGGCATTCCATCGGTGAGGTCACGGCTGCCTATTTGGCGGGT
GTGTGGTCGCTGGCGGATGCGGCGAAGCTGGTGGCGGCTCGTGGGCGGTTGATGCAGGCT
CTGCCGGCCGGTGGTGTGATGGTGTCGGTGCGGGCGTCGGAGGGCGAGGTCGCGCCGCTG
CTGGAGGGCCGGGAGCAGGTCGGGATCGCTGCCGTCAATGGTCCTGAGTCCGTCGTGGTC
TCGGGTGCCGAGGCCGAGGTGGAGCAGATCGCTGCCGTCCTGGAGGCCGAGGGGCGTAAG
GTCAAGCGGCTGCGGGTGAGCCATGCTTTCCACTCGCCGCTGATGGACCCGATGCTGGCC
GACTTCCGCACGGTCCTGGACCAACTCACGTACGACGAAGTCAAGTTGCCGGTCGTGTCG
AATGTGACCGGCCGTCTCGCTGAGCCCGCCGAGCTTCGTGACCCGGAGTACTGGGTGCGG
CATGTCCGGGAGGCCGTCCGTTTCCACGACGGTATGCGCGCTGCCTACGACGAAGGCGTC
ACCACCTTCCTCGAACTTGGCCCCGATGGCGTCCTGGCGGCCATGGGGCAGGACTGCCTC
CGCGAGGTCGAGGGCACTCCCGCGGCCTTCCTGCCCGGTCTGCGCAAGGACCGGTCCGAG
CCGGAAGCCGTCCTCCAGGCCCTTGGCGCTGCGCACGCGCGGGGTGTCGTGGTGGACTGG
GCGACGTTCTTCCCCGGCGCCCGCCAAGTGGCCCTTCCCACCTACGCGTTCCAGCGACAG
CGGTACTGGCTGGACCGCACCGGCGCCGGCACCGGCGATATGACCTCGGCCGGTCTGGGC
GCTGCGGATCACCCGCTGCTCAGCGCTGCCGTCGCCCTGCCGGATTCGGACGGGTTCCTC
TTCACCGGCCGGCTGTCTCTGGCCACCCACCCCTGGCTGGCCGACCACGCCGTCCTCGGA
ACCGCTGTGCTGCCGGGTTCTGCGCTGGTGGAGCTCGCTATCCGGGCCGGGGACCAGGTC
GGCTGTGACCTGCTGGAAGAACTCACCGTGCGGGCGCCGCTGATCCTGCCGGAACGCGGT
GGAGTGCAGCTCCGGGTCGCGCTCGGCCAGTCCGCGGTGGACGGTCGCCGTGAGATTGCG
GTGTTCGCCCGCGATGAGGAAGCGGTGGACGAGGCGTGGACCCGGCATGCCGACGGAGTG
CTGGCCGCGGGGGCACCCGTCGGCAGCATCGACGCTCCGGTATGGCCGCCGGTCGGCGCG
GAAGCCGTCTCCGTGGAAGGGCTGTACGGGGAGCTGGCCGCGGCCGGGTTTGAGCACGGG
CCGGTGTTCGGCGGCGTGCGAGCGATGTGGCGCCGTGGCGATGAGGTCTTCGCCGAGGTC
GCTCTGCCCGAGGAAATCGCCGACCGGGCGGGCGAGTTCGGCCTGCATCCGGCATTGCTG
GACGCGGCCCTACAGCCGGTGACTGGTGGGCTGCGGCTGCCGGTCTCCTGGTCCGGGGTG
CGGCTGCACGCGGTGGGCGCGGTGTCGTTGCGGGTGCAGCTGACCAAGGCCCGTGACGGC
TATGCGCTGACTGCGACGGACGAGGCCGGCGGCCTGGTGGCGTCGGCGGACGGGGTGACG
TGGGGCGCGGTCTCCGCCGAGGAGTTCGCAAACGCCGGGGTGCGGCACCGGGATTCGCTG
TTCGGGGTGGAGTGGTCGGAGTTGCCGCTTCGGTCTGAGCCGGTGGCGGGTTCGTGGGCG
GTCCTTGGTGAGGATGCGGGGCTGGCTGCGGCGTTGGGTGCGGACGTACTGAGCGAGCTG
GTGGACGTGCCGGAGCATGTCGTGCTGGCGGTGCCTGGCACGGATGGTGCGCTGGAGGTG
CCGGCCGCGGTTCGGGCCACGGTGGGCCGGGTGCTGGAGAGCGTGCAGTCGTGGCTGGCT
GATGAGCGTTGCACGCGTTCGAAGCTGGTGGTGGCGACTCGTGGTGCCGTGTCGGTGGCG
GGGGAGCCGCTGGATGCGGTGGGCGGCGCGGTGTGGGGTCTGTTGCGCTCCGCCCAGGCC
GAGAACCCGGGCCAGTTTGTGCTGCTTGACCTTGATGAGCAGCAGTCCTCGGTGGAGGCC
GTCGCTGCGGCGGTTGCTTCGGGTGAGCCGCAGTTGGCGGTTCGCGACGGGGTGGTGTCC
GTGCCGCGGCTGGTGCGGACTACGCCGTCGGACAACGCGCCGGTGTGGGGCTCCGAGGGC
ACGGTGCTGATCACGGGTGGGACCGGAACCTTGGGTGCGTTGTTTGCCCGTCATCTGGTG
TCTGAACACGGTGTCCGCAGCCTGGTGTTGACCAGTCGCCGTGGGCTTGAGGCCAATGGC
GCTCAGGAGTTGCAGTCCGAGCTGACGGAGCTGGGCGCTCGGGTCGAGGTCGTGGCGTGT
GACGCGGCTGACCGGGAGGCACTCGGGGAGCTGCTGGCAAGCATCCCGGCCGACGCCCCG
CTGACGGGTGTGGTGCACACTGCCGGTGTTCTGGACGACGGCATCATCGGCTCGCTGACC
CCGGAACGTCTCGACACTGTTCTGCGGCCGAAGGTGGACGCGGCCTGGAACCTGCACGAG
CTGACCCAGGGCCTGGACCTGTCGGCATTCGTGCTGTTCTCCTCCGCTGCCGGTGTGCTC
GGCAGCGCCGGACAGGGCAACTACGCGGCGGCCAACTCCTTCCTCGACGCGCTCGTTGAG
CACCGTCGGCTCAGTGGTCTGCCGGGTACCTCCCTGGCCTGGGGCCTGTGGGCCGATGCC
AGTGGGATGACCGGGCAGCTCAGCGAAACCGACCTGCGGCGGATGGCGGCCGACGGCGTG
CTGCCGGTCTCCGCCGCCGAAGGCGTGGACCTGTTCGACGCGGCGATCGCCGTGGAATCG
GCGCTGTCCGTACCGATCCATCTCGATGTGCGGGCCCTCGCCGCCGCGCCTTCGGTACCG
GCCATCCTGCACGGCCTCGTACCGGTCCGGCGGCGCACTGCCGCGGCCGGCGGCGGTGCC
GGCAGCACATTGCGGGACCGGCTCGTCGTGCTGACGAAGGCCGAGCAGGATCGTGCTCTG
CTGGACCTTGTCACCGCCCAGGTCGCCCTGGTGCTGGGCTACTCCGACAGCAGTGGGCTC
GATGCGTCCCGGGCGTTCAAGGACCTCGGGTTCGACTCGCTCACCGCCGTGGAACTGCGT
AACCGGATGGACAACGCCACCGGTCTGCGGCTGCCGGCCACGCTGATTTTCGACTACCCC
ACTCCGTCCGCGATGGTGCGCCATCTGCGGGAGGAACTGCTCGGCGGGCAGACCGCCACC
CCCGCGGTACGTGCCAAGGCGGCCGTGGACGACGAGCCCATTGCCATTGTCGGCATGGCC
TGCCGGTTCCCCGGCGGGATCGACAGCCCCGAAGCGCTGTGGGAACTGCTGGCGCGTGGC
GGCGATGCGATCGGTGACTTCCCGGCCGACCGTGGCTGGGACGTGGAGCGGCTGTACCAC
CCGGACCCGGAGCACAAGGGCACCTCGTATGTGCGCGAGGGCGGTTTCCTCGGCAACGCC
GGTGACTTCGATGCCGGGTTCTTCGGCGTCTCGCCGCGTGAGGCGACCGCGATGGATCCG
CAGCAGCGGATCCTGCTGGAAACCTCCTGGGAGACCCTGGAGAACGCGGGCATCGACCCG
ACCACCCTGCGGGGCAGCGACGCCGGTGTCTTCGTCGGCACCAATGGCCAGGATTACGGC
TCGGTCCTCGCCCAGGGCACGGACAACGCGGACGGCTACCTGATCACCGGAACCTCGGCC
AGCGTGGTGTCGGGCCGGGTCTCCTACTCACTCGGTTTCGAAGGCCCCGCGGTCACCGTG
GACACGGCGTGCTCCGCCTCGCTGGTGGCGCTGCACTGGGCGATGCAGGCACTGCGGTCC
GGTGAATGCTCGCTGGCCCTGGCCGGCGGTGTCTCGGTGATGTCCACTCCCGACACCTTC
GTCGACTTCTCCCGGCAGCGCGGCCTCGCGGCGGACGGCCGCTGCAAGCCGTTCGCCGCC
GCGGCGGACGGCACCGGCTGGGGCGAGGGCGTCGGCATGCTGCTCGTGGAGCGGCTCTCC
GATGCCCGGCGTAACGGCCATACGGTCCTTGCGGTGGTGCGGGGTTCGGCGGTGAACCAG
GACGGTGCGTCCAACGGTCTGACCGCCCCCAACGGACCCTCGCAGCAGCGGGTGATCCGG
CAGGCCCTCGCCGGCGCGGGTCTGGAGCCGTCCGAGGTGGATGCGGTGGAGGCGCACGGC
ACGGGCACGCGGCTGGGCGACCCGATCGAGGCGCAGGCGCTGCTGGCCACGTACGGCCAG
GGCCGGCCCGCCGACCAGCCCTTGTGGCTCGGTGCGATCAAGTCCAACCTCGGGCACACC
CAGGCCGCGGCCGGCGTCGCCGGCGTCATGAAGATGGTCCTCGCCATGCGCCAGGGCCTT
CTGCCCAAGACCCTGCACCTGGACGAGCCCACCCCGCATGTCGATTGGTCCGCGGGTGCG
GTCGAGCTGCTCGCCGAGGCACAGGAGTGGCCGGACACCGGCCGCCCCCGCCGCGCCGGT
GTGTCGTCGTTCGGTATCAGCGGGACGAATGCGCATGTGGTGCTGGAGCAGGCTCCTGAA
GAGGAGCGGGTGGAGTCGGCTGCTCCGGCGGTGGTGGAGCCGGGGCCGGGGCCGGTGCCG
TGGGTGTTGTCTGCTCGTTCTCCGCAGGCGTTGGTGGGGCAGGCGGAGCGTCTTGGGGCG
TTTGTGGCGCGGCAGCCGGAGTTGGGGCTTGCTGATGTCGGGTTCTCGCTTGCGACGAGC
CGTGCGGGGTTGGAATACCGTGCCGTGGTCACGGGTTGGGACCGGGAGTCGCTGCTTGGT
GCTTTGGGGGCACTGCCTTCGGTGAGTGGGCCGGTGGCTGGTGAGGGACGGCTTGGTGTG
CTGTTCACCGGCCAGGGCGCACAGCGGCTGGGAATGGGCCGTGAGCTGTATGAGACCTAT
CCGGTGTTTGCGCGGGCCTGGGATGAGGTGTGTGCGGAGCTGGACGGTCTGCTGCCGCGG
CCGCTGACGGAGGTGGTCTGGGGCGAGGATGACCTGCTCGATCAGACGCAGTACGCCCAG
GCGGCGCTGTTCGCCCTCGAAGTCGCGCTCTACCGGCTCGTTGAGTCGCGTGGTGTGACG
CCGGCTGTGTTGCTGGGGCACTCCATCGGTGAAGTGACGGCTGCCTATTTGGCGGGTGTG
TGGTCGCTGGCGGATGCGGCGACGCTGGTCGCGGCACGTGGGCGCCTGATGCAGGCCCTG
CCCGCCGGCGGCGTCATGGTGTCGGTGCGGGCCTCGGAGGACGAGGTCGCCCCGCTGCTG
GAGGGCCGCGAGCAGGTCGGCATCGCTGCCGTCAACGGCCCAGAGTCCGTCGTGATCTCC
GGCGCCGAGGCCGAGGTGGAGCAGATCGCTGCCGCCCTGGAGCGGGAGGGCCGCAAGGCC
AAGCGCCTGCGGGTGAGCCATGCCTTCCACTCGCCGCTGATGGACCCGATGCTGGCCGAC
TTCCGCACGGTCCTGGACCAACTCACCTACAACGACGCCCGGTTGCCGCTGATCTCGAAC
GTGACCGGTGAGCCGGCCGACTCGGCCGAACTCCGCAACCCCGAGTACTGGGTCCGGCAC
GTCCGGGAAGCCGTCCGCTTCCACGACGGCATCCAGGCCGCGCAGTCCGAAGGTGTCACC
ACCTTCCTGGAACTCGGCCCCGATGGTGTGCTCTGCGCCATGGGGCAGGACTGCCTGCCA
GAGACCGTCACCCTTCAGCCGAGTCTGCGCAAGAAGCGGTCCGAGCCGGAAGCGGTTCTC
CAGGCTCTGGGCGCCGTATACGCGCGGGGTGTCGTCGTGGACTGGGCGACGTTCTTCCCC
GGCGCCCGACAAGTGGCCCTTCCCACCTACGCGTTCCAGCGGCAGCGGTACTGGCTGGAC
CGCACCGGCGCCGGCACCGGCGATATGACCTCGGCCGGTCTGGCCGCCGCGGATCACCCG
CTGCTCAGCGCCGCGGTGCCGCTGCCCGGATCCGACGGGTTCCTCTTCACCGGCCGGCTG
TCCTTGGCCACTCACCCCTGGCTGGCCGACCACGCCGTCATGGACACCGTTCTGGTGCCC
GGCACCGCGCTGGTCGAACTCGCCATCCGTGCCGGGGACCAGGTCGGTTGCGATCTGCTG
GAGGAGTTGACCCTTCAGGCGCCGATGATCATCCCGTCGGCCGCCGGCATACAGATCCAG
ATCACCGTGGATGGTCCGGACGCCCACGGCCGACGCGAGCTGTCCATGTTCTCCCGTGGC
GAGGACGGTGCGGAGCCGTGGACCCAGCATGCGCTGGGCGTGCTGACCACCGCAGGTGCC
ACACCCGTCCTGGACCTGGGTGAAGCGGCCTGGCCGCCGGCCGGGGCGGAGGCCGTCTCC
GTGGACGGCTTCTACGCGGAACTCGTCGACGCCGGATTCGGCTACGGTCCGGTGTTCCAG
GGGGTAAGGGCGGCCTGGCGACGCGGCGCGGAGCTGTTCGTCGAGGTCGCGCTGCCCGAG
GGCGCGGCCGAGCAGGCCGCCGAGTTCGGGCTGCACCCTGCCCTGCTCGACGCCGTACTC
CAGACCTTCGGTCTCAGCGACGACCTCGGCACGGACGGCCCCGGTCTGCCCTTCGCCTGG
GCCGGAGTGCGCCTGCACGCCGTCGGCGCGGCCTCCTTGCGGGCCCGGCTGACGCCGACG
GGCGACGGCGGAATGCGGATCCTGGCCGTCGATGACGCGGGCGCCCCGGTGGCCACCATC
GACGCCCTGACCACCCGACCGGTGCCTGCCGCCGGGCAGCTGGCGAGTGCTGGCGGCGGA
CGGCGGGAGGAGTTGTTCGCGGTGGAGTGGGCGCCGGTCGCGCTGCCCGCCGGGGACGTG
GACGGCTCGTGGGCGGTGGCCGACGAGGATGTGGTGCTGGCGGCCGGTCTGGGCGTGGCA
GTCCTGGATCCGTCGGCAGAGTCGGTGCCGGGTCATGTGGCGTGGTCCCCGGCCGTGGAG
ACGGGCGCGAGCGCGGTGGTTCCGGGCTCGGTGCGCGGTGCCACGGCTGAGGTGTTGCAG
CGGGTACAGGTCTGGCTGGCGGATGAGCGGTGCGACGGTTCGACGCTGGTGGTGGTGACC
CGGGGCGCCGTCTCGATGGCGAGCGAGCCGGTTGAGGTGGCGGCGGCCGCGGTGTGGGGG
CTGGTGCGGTCCGCGCAGTCGGAGAATCCGGGCCGGCTCGTGCTGGTCGATGTGGACGGC
GAGGCGAATTCGCTCCAGGCGGTCCGTGCGGCCGTGGCGTCCGGCGAGCCGCAGCTGGCG
ATCCGGAACGGTGTGGTCTCGGTGCCGCGGTTGGCACGGACCGTGCCGTCCGGAGTGGAT
GGTGCGCGGGTGTGGGACCCCGAGGGCACGGTGCTGATCACCGGTGGCACTGGAAACCTG
GGTGCGTTGTTCGCCCGTCATCTGGTGTCCGAACACGGTGTCCACAGCCTGGTGTTGACC
AGCCGCCGGGGCCTGGAGGCTGTCGGCGCACGGGAGTTGCAGTCCGAGCTGACGGAGCTG
GGTGCCCGGGTCGAGGTCGTGGCGTGTGACGCGGCTGACCGTGACGCGCTGGCCGCCGTG
CTGGCAAGCATTCCTTCCGACGTCCCGCTGACGGGTGTGGTGCACACGGCAGGTGTTCTG
GACGACGGCATCATCGGCTCGCTGACCCCGGAACGTCTCGACACTGTTCTTCGGCCGAAG
GTGGACGCGGCCTGGAACCTGCACGAGCTGACGCAGGGCATGGACCTGTCGGCGTTCGTG
CTGTTCTCTTCGGCCGCCGGTGTGCTCGGCAGCGCCGGACAGGGCAACTACGCCGCGGCC
AACTCCTTCCTCGACGCGCTCGCTGAGCACCGTCGGCTCAGTGGCCTGCCGGGTACCTCC
CTGGCCTGGGGGCCGTGGGCGGCGGACACCAGCGGAATGACCGGCCAGGTCGAGGACACC
CATCTGCGGCGGATGGCCGCGGACGGGTTCCTGGCGATCTCCGCGGCCGATGGCACCGCG
ATGTTCGACGCGGCCGTCGGCGCCGAAGAGGCCGTGATCGCACCGATCCGACTGGACGCG
CGGGCCCTCGCGGCCTCCGGGGCGGTGCCGGCGATCCTGCGCGGAGTGGTGCGGGTTCCC
GCACGCCGCACCGCGGCCGAGGCCACCTCGGCCGGATCGCTGGGCGACCGCCTGCTCGGC
CTCCCCGTCGAGGAACGCGATGAGCTGCTGCTCGACCTGGTGACCACCCAGGTGGCGGCC
GTACTGGGCTACGAGAACTCGGGTGCGGTCCGTATCGACCAGGTATTCAAGGACCTCGGA
TTCGACTCGCTGACGGCGGTCGAACTGCGCAACCGGCTCAACTCGGCCACCGGCCTGCGG
CTGCCCGCGACCCTGGTGTTCGACTACCCGACGCCGGCCGCGCTGCTGGACCACCTGCGG
GACGAGTTGGTCGGGGACCGGGATCAGCCGGCTGTCACCAGCGTTGCCACCAGTACGACG
GTGGACGAACCCATCGCCATCATCGGTATGGCCTGTCACCTGCCTGGCAACGTCCACAGC
CCCGAGGACCTCTGGCGCATGCTGGAAACCGGGCGGGACGGCATCTCCGCCTTCCCCGGC
GACCGCGGCTGGAACCTCGATGCCCTGTACCACCCGGACCCCGACCACCACGGCACCTCC
TACACGCGCGAGGGAGGTTTCCTCGACGGCGCCGCGGACTTCGACCCCACCTTCTTCGGG
ATCAGCCCGAACGAGGCGCTGGCCATGGACCCGCAGCAGCGGCTCCTGCTGGAAACCTCC
TGGGAGGCCCTGGAGAGCGCGGGAATCGACCCCACCACCCTGCGCGGCACCCCGACCGGC
GTATACGCCGGGCTCATGTACCACGACTACGTCAACCAGTTGCAGTCCGTGGGCGAGGGC
GTCGAGGGCTTCATGGGCACCGGCAACTCCGGCAGCGTGACCTCCGGCCGGCTGGCCTAC
TCCTTCGGGTTCGAAGGGCCCGCGGTCACCGTGGACACCGCGTGCTCGTCCTCTCTGGTG
GCCCTGCACTTCGCGGTGCAGGCGCTGCGGTCCGGCGAATGCTCGCTGGCCCTGGCCGGC
GGTGTGACCGTGATGGCCACCCCCGATACGTTCATCGACTTCTCCCGGCAGCGCGGCCTG
TCCGCGGACGGCCGCTGCAAGCCGTTCGCCGCGGCCGCGGACGGTACGGGCTGGGGCGAG
GGCGTCGGGATGCTGCTCGTCGAGCGGCTCTCGGACGCCCGGCGCAACGGTCACCGGGTC
CTTGCGGTGGTGCGGGGTTCGGCGGTCAACCAGGACGGTGCGTCCAACGGTCTGACCGCG
CCGAACGGTCCCTCGCAGCAGCGGGTGATCCGGCAGGCGCTCGCCGGCGCACGACTGTCC
CCGTCCGAGGTGGACGCGGTGGAGGCGCACGGCACCGGTACGAGACTGGGTGACCCGATC
GAGGCCCAGGCGCTGCTGGCCACGTACGGCCAGGACCGCCCGGAGGACCGGCCGCTGTGG
CTGGGGTCCATCAAGTCGAACATCGGTCACACTCAAGCCGCGGCCGGTGTCGCCGGCGTG
ATGAAGATGATCCTTGCCATGCAGCAGGGGATCCTGCCCAAGTCGCTGCACGTGGATGAG
CCCTCCCCGCATGTGGACTGGGCCGCCGGCGCGGTCGAACTGCTCGCCGAGGCGCGCGAA
TGGCCGGACACCGGCCGTCCGCGTCGGGCGGGTGTGTCGTCCTTCGGCATCAGCGGGACG
AATGCGCATGTGGTGCTGGAGCAGGCCCCTGAAGACGTCCCGGCCGAGCCGGTCGAGGAG
TCCCGGCCCGGGGCCCTGCCGTGGGTGCTGTCGGCGCGTTCGGAGCAGGCGTTGGCGGCT
CAGGCGGGCCGGTTGGTGTCCTTTGTGGAACAGCGCCCGGAGGTGGGCCCGGCTGATGTC
GGGTTCTCCCTGCTGAGCACACGGGCGGAGCTGGAGCACCGGGCCGTGGTGGTCGGCGCC
GATCAGGATCAGTTGCTGAGCGGCTTGCGTGGCCTTGCCGGTGGGTTTGCCGGTGGCCTG
GATGGTGCCGGTGTGGTCCAGGGCAGTGTGGCGGCTACGGCAGCTTCTGGTGCGGTGCTG
GTCTTCCCTGGTCAGGGTTCGCAGTGGCTGGGTATGGCGGATGAACTGCTGGCTACGTCG
CCGGTGTTCGCGGGGCGGATGGCTGAGTGTGGTGCGGCGCTGTCGGAGTTCGTGTCCTGG
GATCTGATGGCGGTGCTGTCGGATGAGGACGCGTTGGCGCGGGTTGATGTGGTGCAGCCG
GTGCTGTGGGCGGTGATGGTGTCGCTGGCTGCGGTCTGGGAGGACTGCGGTGTGGTGCCG
TCGGCTGTGGTGGGTCATTCTCAGGGTGAGATCGCTGCGGCTTGCGTCGCCGGGATCCTG
TCGTTGCGTGATGGTGCCCGGGTGGTGGCGTTGCGCAGTCAGGCCATCGGCCATGTCCTG
GCTGGTCGCGGCGGCATGGTCTCCGTCGCCGGCTCGCGCGAGGCGGTTCAGGAGCGCATC
GCCAGGTGGGGCGAGCGGCTGTCCGTGGCCGCTATCAACGGGCCGTCCGCCACGGTGGTT
TCCGGTGAACCGGATGCGTTGCAGGAGTTGCTGGCGGAGTGCGCTGAGCAGGAGGTGCGG
GCCCGGCAGATTCCGGTGGATTATGCCTCGCACGGCGCGCAGGTTGAGGAGCTGCGCGAG
GAGCTCGCGACGGTTCTGGCTGAGGTGGCGCCTGCGGAAGGCCGTATCCCGTTCTACTCG
GCGGTGCATGCGTCAGCCGTCTCGGGCGAGGAGCTGGATGCTGCGTACTGGTTCGAGAAC
CTGCGCAATCCGGTGCGGTTCGAGGAAGCCGTCCAGGCGCTGCTGTCCGACGGCCATGGC
GTCTTCGTCGAATGCAGCGCGCACCCCGTCCTGACTCCGGGCATCGAGGACACCGCGCAA
AGGGCGGGCAGCCCCGTTGTGGTGACCGGGACCCTGCGTCGTGAAGAGGGTGGCTGGTCC
CGGTTCGCGCAATCGCTGGGCCAGCTCTGGGCGCACGGCGTCCAGGTGGACTGGAGCACC
CTGGTTCCGGCCGGTCGGCGGGTCGACCTGCCCACTTATGCCTTCCAGCACAAGCGCTAC
TGGCCCGCCACTGTGGTCGCGGCCGGTGACGCCACCGGCCTCGGCCAGGCGGACTCGCAG
CATCCCCTGCTGGGCGCGGCCGTGGCCCTGCCCGAGTCCGACGGCTACCTGCTCACCGCG
CGGCTGTCCCTGGCCACGCACCCCTGGCTGGCCGACCACTCGGTACTCGGCGCCGTGGTG
CTGCCGAGTTCCGCCCTCGTGGAGCTGGCCATCCGGGCCGGTGACCAGGTCGGCTGCGAT
CTGCTGGAAGAACTCACCGTGCTGGTTCCGCCTGTCCTGTCGGAAGGCGCCGGGCTCCAG
CTCCGAGTCACCGTCGGCGAGTCCGATGCGGACGGGCGGCGGGAGCTGGCTGTGTTCTCC
CGCAATGAGGACGCCGAGGCTGATCTGCCCTGGACCCGGCACGCCACCGGTCTACTGGCC
GCGGGCGCTGCACCCGTCGGATTCGGCGAAGCGGTCTGGCCCCCGGCCGGCGCCGACACC
TTGACGGTGGACGGGCTCTACGACGAACTCGCCGCCGCCGGGATCACCCATGGCCCGGTC
TTCGAGAACGTCCGAGCGGCCTGGCGCCGCGGTGCGGACCTGTTCGCCGAGGTCGCTCTG
ACGGAGGAGAACGCGGGCGAGGCGGGCCGATTCGGTCTGCACCCTGCCCTGCTCGATGCC
GCGCTCCAGCCGGTGACGCGCCAGGAAGCTGCGGACGGGACACAGCTCGCCACGCAATGG
ACGGGTGTGACGCTGTTCGCCGACGGCGCGACCGCGCTGCGGGTCAAGCTCTCCAGCGTG
GGGGACGGCTACGCCCTCGTAGTCGCCGATCACGACGGCGAAGTGGTCGCCGCGGCCGAA
TCCATTGCCTGGACGGCGATTTCCGAAGCGGAAGTGGCGGTCGCCGGCCCGGGGCACCGG
GATTCGCTGTTCGGGGTGGAGTGGTCGGAGTTGCCGCTTCGGTCTGAGCCGGTGGCGGGT
TCGTGGGCGGTCCTTGGTGAGGATGTGGGGCTGGCTGCGGTGTTGGGTGCGTCGGGTGCG
GACGTGCTGAGTGAGCTGGTGGAGGTGCCGGAGTGTGTGGTGCTGGCGGTGCCTGGCGTG
GATGGTGCGTTGGAGGTGCCGGCGGCGGTTCGGGCCGCGGTTGGTCGGGTGTTGGAGGGT
GTGCAGTCGTGGCTGGCTGATGAGCGTTGCACGCGTTCGAAGCTGGTGGTGGCGACTCGT
GGTGCCGTGTCGGTGGCGGGGGAGCCGCTGGATGCCGTGGGCGGCGCGGTGTGGGGCCTG
CTGCGTTCCGCACAGACCGAGAACCCGGATCAGTTCGTGCTCATCGACCTTGACGAGTGT
GAGTCGTCGGTGGAGGCCATCGCTGCGGCGGTTGCTTCGGGTGAGTCGCAGTTGGCGGTT
CGCGACGGGGTGGTGTCCGTGCCGCGGCTGGTGCGGACTACGCCGTCCGACAGCGCGCCG
GTGTGGGGCTCCGAGGGAACGGTGCTGATTACCGGTGGCACGGGCACATTGGGTGCACTG
TTCGCTCGGCATCTGGTGTCTGAACACGCTGTCCGCAGCCTGGTGTTGACCAGTCGCCGT
GGGCTTGAGGCCAATGGCGCTCAGGAGTTGCAGTCCGAGTTGACTGAGCTGGGCGCTCGG
GTCGAGGTCGTGGCGTGTGACGCGGCTGACCGTGACGCGCTGGCCGCCGTGCTGGCAAGC
ATCCCGGCCGACGCCCCGCTGACGGGTGTGGTGCACACGGCAGGTGTTCTGGACGACGGC
ATCATCGGCTCGCTGACCCCGGAGCGACTGGACACCGTGCTTCGGCCGAAGGTGGACGCG
GCCTGGAACCTGCATGAGCTGACGCAGGGCATGGACCTGTCGGCATTCGTGCTGTTCTCT
TCGGCCGCCGGTGTGCTCGGCAGCGCCGGGCAGGGCAGTTACGCGGCGGCGAATACGTTC
CTGGATGCGCTCGCTGAGCACCGTCGGCTCAGTGGTCTGCCGGGTACTTCCCTGGCCTGG
GGCCTGTGGGCCGATGCCAGTGGGATGACCGGGCAGCTCAGCGAAACCGACCTGCGGCGG
ATGGCCCGGGGCGGGATGATCCCGCTCGGCCAGGCCGAAGGCACCGCGCTGTTCGATGCG
GCCATGGCCACGGACCAGCCGGTTGCGCTGTCCGCCCATCTCGACCTGAACACCATTGCC
GCCACCGGAGAGGTTCCGTCGCTGCTGCGCAGCCTGGTGCGGGTCCGGCGCCGTGCCGTG
ACCACCGGCAGCGCGACGGCCGACACCCTCGCCGAGCGACTGCGCCCGATGACCGAGGCG
GAGCGTGAGCGGACCTTGGTGGAACTGGTCCGCCGGCAGGCCTCCGCCGTCCTCGGCTAC
GACGGCGGCGACGCCGTGGGGACCACACGGGCCTTCAAGGAACTCGGCTTCGATTCGCTC
ACCGCGGTCGAACTGCGGAACCGGCTGAACGCGGCCACCGGGCTGACCCTGCCGGCCACG
CTGATCTTCGACTACCCGAACCCGGAGGCCCTCGCCCGCTACGTACGCGAGGAACTGCTG
GGCACGGTGGCCGCACCGGTCGCCACGGTCCCGGTGGCCCGGCCCGTCGACGACGACCCC
ATCGTGATCGTCGGCATGGCCTGCCGCTACCCCGGAGGGGTGGCCTCGCCGGACGACCTC
TGGCAGCTCGTGACCAGCGGTGGGGACGCCATTTCCGGCTTCCCCGTGAACCGCGGCTGG
GACCTGGACAACCTGTTCGGCAGCGACTCCGCCGAAACCGGCAAGAGCATCACCCAGCAG
GGCGGATTCCTTTACGACGCGGGCGAGTTCGATGCCGGCTTCTTCGGGATCAGCCCCCGG
GAGGCCTTGGCGGCCGATCCGCAGCAGCGGATTCTGCTGGAGGCCGCCTGGGAGACCTTC
GAGAACGCCGGTATCGACCCGTTGGCCTTGAACGGCAGCCAGACCGGGGTCTTCACCGGG
ATCAACTACCACGACTACGCGCCCGCCGACGGAAACGTCCCCGAGGACATCGAGGGCTAC
CTCACCACCGGTGGCGCGGGCAGTGTGCTCTCCGGCCGTATCTCCTACTCACTCGGTCTC
GAAGGGCCCGCGGTGACCGTGGACACGGCCTGCTCCTCGTCACTGGTGGCACTGCATCTG
GCGATCCAGGCGCTGCGCACCGGGGAGTGCTCGATGGCCCTGGCCGGCGGTGTCTGCGTC
ATGGCCACCCCCGGCAACTTCGTGGAGTTCTCCCGGCAGCGCGGTCTCGCTGCGGACGGC
CGCTGCAAGCCGTTCGCCGGCGCCGCGGACGGCACCGGCTGGGCTGAAGGCGCCGGCATG
GTGCTCGTCGAGCGGCTGTCGGATGCCCGGCGGAACGGCCACCCGATCCTGGCCGTCGTC
CGGGGTTCGGCGGTGAACCAGGACGGTGCGTCCAACGGTCTCACCGCCCCCAACGGCCCC
TCGCAGCAGCGGGTGATCCGTCAGGCCCTCGCCAACGCCGGACTCGAACCGTCAGACGTG
GATGCTGTGGAGGCCCACGGCACCGGTACGACACTGGGCGACCCGATCGAGGCCCAGGCG
CTGCTCGCCACGTACGGGCAGAACCGGCCCGCCGACCAGCCGCTGTGGCTCGGTGCGGTC
AAGTCCAACATCGGGCACACCCAGGCCGCCGCCGGTGCGGCCGGAGTCATCAAGATGGTC
TTCGCGCTCCAGCAAGGGCTGCTGCCCAAGACCCTGCACGTGGACGAGCCCACCCCGCAT
GTCGACTGGACCGCGGGTGCGGTGGAGCTGCTCACCGAGACGCGGAAGTGGCCGGAGACC
GGCCGCCCGCGCCGGACCGGTATCTCCGCCTTCGGCATCAGCGGCACCAACGCCCACGTC
ATCCTTGAGCAGGCTCCCGTAGAGGAACTCGCCACTACGGAAGCCACCAAGACGGGACTC
GCGAAGACGGAACTCGCGAAGACGGAACTCGCGAAGACGGAACTCGCGAAGGCGGAACCC
GGCGAGGCCGCGTCCGCCGCGAGCGGGCCTGCCGATGCGCTGTCCTGGATACTCTCCGCG
CGGACGCAGGAAGCCCTGTACGCGCAGGCGGCACGGCTGGTGGCCTTCGCCACCGAACAC
CCGGAACTGGCCCCGGCCGAGATCGGGTTCTCACTGGCCACCACCCGCGCGGCGTTGGAG
CACCGCGCGGTCGTTGCCGGGGCGGACCGGGATGCCCTGCTGGCCGCGGCCGGACGACTG
GCCGCGGGCGAGCACCCCACAGCGGTCGCCGGCGATGGCCGGGTCGGCGTGCTGTTCACC
GGCCAGGGTGCGCAGCGACTCGGCATGGGCCGTGAGCTGTACGACGCCTACCCGGTGTTT
GCGCGGGCCTGGGATGAGGTGTGTGCGGAGCTGGACGGTCTGCTGCCGCGGCCCTTGCGT
GAGGCGGTCTGGGGCGAGGATGACCTGCTCGATCAGACGCAGTACGCCCAGGCGGCGCTG
TTCGCCCTCGAAGTCGCCCTCTACCGCCTCGTCGAATCCCACGGTGTGACGCCGGATGTG
CTGCTGGGGCACTCCATCGGTGAGGTCACGGCTGCCTACCTTGCCGGTGTGTGGTCGCTG
GCGGACGCGGCGAAGCTGGTCGCCGCACGTGGGCGCCTGATGCAGGCCCTGCCCGCCGGC
GGCGTCATGGCGTCGGTGCGGGCCTCGGAGGACGAGGTCGCCCCGCTGCTGGAGGGCCGG
GAGCAGGTCGGGATCGCTGCCGTCAACGGCCCCGAGTCCCTCGTGGTCTCGGGTGCTGAG
GCCGAGGTGGAGCAGATCGTCGCGGCCCTGGAGTCTCAGGGGCGCAAGGTCAAGCGGCTG
CGGGTGAGCCATGCTTTCCACTCGCCGCTGATGGACCCGATGCTGGCCGACTTCCGCACG
GTTCTGGAACAACTCACCTACAACGAAGCCGAGTTGGCGCTGATTTCGAACGTGACCGGC
CGTCTCGCCGACCCCGCCGAGCTTCGTGACCCGGAGTACTGGGTGCGGCACGTCCGGGAA
GCCGTCCGCTTCCACGACGGCATCCAGGCCGCCCACGCCGAGGGTGTCACCACCTTCCTC
GAACTCGGTCCGGACGGCGTCTTGTCCGCCATGGGCCAGGACTGCCTACCGCAGACCGCC
ACTACTACCGCCCCCGTCACCCTCCAGCCGACCCTGCGCAAGGACCGCCCCGAACCCGGA
GCGCTGATGGACGCACTGGGCGGGCTGTGGGCCCGTGGCGTCGCGGTGGACTGGGCCCCG
CTGTTCCCGGGGGCCCGCCGGGTGGCGCTGCCCACCTACGCGTTCCAGCGGCAGAACTAC
TGGCTACCGGCCAACGCGGGGAGCGGCAACGTGTCCTCGATCGGGCTGGGCGCCGCGGAC
CATCCGCTGCTCGGCGCGGCGGTCAGCCTGCCGGATGCGGTGGTCCTCACCGGGCGGCTG
TCCCTGGCCACGCATCCGTGGCTGGCCGACCACACCATCATGGACACCGTGCTGCTGCCG
GGAACCGCCCTGGTCGAACTCGCCATCCAGGCCGGCGACCAGGTCGGCTGCGATCTCCTG
GACGAACTCACCCTGCACGCCCCGCTGATTCTCCCGCCGCACGGCGGAATGCAGCTGCGC
GTCACGGTCGGGGAGGAGTCGGCCGGGGACGGGCGCCGCGAACTCGCGGTGTATTCCCGG
AACGAGAACGAACCCGAGCTGGAGTGGACCCGGAATGCCACCGGCACACTGACCGTCGCG
GCGGATACACCGGAGCGCTTCAGCGAAACTGTCTGGCCACCGGCCGATGCCGAGCCCATC
CCGGTGGACGGGTTCTACGAGGAACTGGTCTCGGTCGGCTTCGCGTACGGGCCGGTGTTC
CAGGGGCTGCGCGCGGCCTGGCGGCGGGGTGCGGAGGTGTACGCCGAAGTGGCCCTGCCC
GAGGAGCCGGGTGCCGATGCGGCGAAGTTCGCCCTGCACCCTGCGCTGCTCGATGCCGCG
CTACAGACCGTGGGCCTGCTCGGGGACGCCGTATCGGGGCTGCCGTTCGCCTGGACCGGT
GTCCGGCTGCACGCCGTCGGTGCGACCGCACTGCGCGTCCGGCTCGCCCCGGCCGGTGAC
GGCGGGGTGCAGGTCCTGGTGGCCGACGAGACCGGTGCGCCGGTGGCCACCATCGATTCC
CTGGTGACCCGGCCGGTGCCGGCCGAACAGCTCGGCTCCAGCACGCGGCGCGGAGCGCTG
TACGAGCTCGCCTGGACCGTCCTCGAAGAGGAAGCCGCCGAGCCGGTATCCGGTAGCTGG
ACCCTGGTCGGCCCGGACGCCGAGAAGATCGCCGAAACCCTGCGGCGGGCGGGCGAGGAC
GTCAGCACCTGCCCGGAGCCGGCGAACGCCGCGGGCCAGGACGTGGCACCGGACTTCGTG
GTGCTGCCGGTAGCGGTGCCGGCGTCCGGTGCCGGGACGGAGGCGACGCCGACCGCGACA
CGTGCGGCGGTGCACCGTGTCCTGGGCACGGTCCAGACCTGGCTTGCCGACGAACGCCTT
GCGGACACCCGGCTGATCGTCCTCACCCGGGGCGCGGTCTCACCCGACGGGGCACCGGCC
GACCTGGTGTCCACGCCGGTCTGGGGCCTGCTGCGTTCCGCGCAGTCGGAGCACCCGGGG
CGGATCGTGCTGGCCGACCTCGACGACGAGGACACCTCGATGGCGAGGCTGCCCGCGCTG
ATCGCCGCCGGTGAACCGCAGGCCGCGATCCGCCGGGGAGTCCTGTCGGTGCCCCGCCTG
GCCGTGCTCGAACCGTCCGGGCAGGACAGCGTCCCGGTGTGGAACACCGGAGGCACGGTG
CTGATCACCGGCGGTACCGGTGTGCTGGGCGCCGAGGTCGCGCGGCACCTGGTGACCGGA
CACGGCGTACGGAACCTGGTGCTGACCAGCCGCAGCGGCCCGACGGCCGAAGGCGCCGAG
GAACTGCGGGCCCAACTCACCGAAGCCGGCGCCCGGGTGGAGATCCTCGCCTGCGATGCG
GCCGACCGGGACGCGCTCGCCGCGGTGCTGGCGGGGATTCCGGCGGACGCTCCGCTGACC
GGGGTGGTGCACACCGCCGGAGTCACCGACGACGGGGTGATCACCTCGCTGACCCCCGAC
CGGGTGGACCGGGTGCTGCGGCCGAAGGTGGACGCCGCCTGGAATCTTCACGAGCTGACC
CAGGACCTGGACCTGTCCGCGTTCGTGCTGTTCTCCTCGGTCGCCGGCATCCTCGGCGCG
CCGGGACAGGGCAACTACGCCGCCGCCAACACCTTCCTGGACGCGCTCGCCGCGCACCGG
AGGGCGGCGGGTCTCCCCGCGGTCTCCTTGCCCTGGGGCCTGTGGGCGCGGAGCAGCGGG
ATGACCGGCAAGCTCGGCGAGGCCGACCTGCGGCGCATCGGAAGCGGCGGGCTCGTACCG
CTGTCTTCCGAGGCGGGTGTGGCACTGCTCGACGCGGCCACCGTGGCCGGTCCGGCCGTG
GTGCTCCCGATGGACCTGGACCCGCGGAAGCTCGCGGCGTCGGGGGACATCCCCGCGGTG
CTGCGCGGAGTGGTGCGGGCACCCGCACGACGGGCGGCGGCAGCCGGTCCGGTCGTGGCG
GAGGTGTCGCTGGGCGACCGGCTGGGGGCGGTACCGGCGGCCGAACGGTCCGGCATGGTG
CTCGATCTGGTGCGCACCCATGTCGCTGCGGTCCTCGGACATGCGGAGACCGGGAAGATG
AAGGCGGATCAGCAGTTCACCGAGCTGGGCTTCGACTCGCTGACCGCCGTGGAACTGCGC
AACCGTTTGCACACCGCCACCGGTCTGCGACTGCCGGCCACCCTGATCTTCGACTATCCG
ACCTCCGCCGCACTCGCGGACCACATCCTCGGCGAGGTGGTGGCGAACGAGCCCGACCCC
GTCGCGACGGTGCTGGCCACCATCGAAAAGCTGGAAGCCGGTCTCTCGATGCTGCGGACG
GAGAGCGGTGACCGAAGGGATATCACCAAGCGGCTGGAGCGTGCGCTGAGCCAGTACCGC
GACGGCGATGCTGCGGAATACGGCGACGACACGGACAGCGATATCCGGGACGCCTCCACC
GATGAACTACTGGACGTCTTTGACCGGGAGTTCGGTAACTCATGA
[4] KS33..409
[4] AT562..876
[4] malonyl-CoA748..752
[4] dh924..1086
[4] KR1380..1560
[4] ACP1660..1730
[5] KS1751..2128
[5] AT2281..2591
[5] malonyl-CoA2467..2471
[5] DH2639..2802
[5] KR3109..3289
[5] ACP3390..3460
[6] KS3482..3859
[6] AT4019..4336
[6] methylmalonyl-CoA4208..4212
[6] dh4381..4544
[6] KR4846..5026
[6] ACP5126..5196
[7] KS5219..5595
[7] AT5778..6094
[7] malonyl-CoA5964..5968
[7] DH6141..6303
[7] KR6618..6798
[7] ACP6900..6970
[4] KS97..1227
[4] AT1684..2628
[4] malonyl-CoA2242..2256
[4] dh2770..3258
[4] KR4138..4680
[4] ACP4978..5190
[5] KS5251..6384
[5] AT6841..7773
[5] malonyl-CoA7399..7413
[5] DH7915..8406
[5] KR9325..9867
[5] ACP10168..10380
[6] KS10444..11577
[6] AT12055..13008
[6] methylmalonyl-CoA12622..12636
[6] dh13141..13632
[6] KR14536..15078
[6] ACP15376..15588
[7] KS15655..16785
[7] AT17332..18282
[7] malonyl-CoA17890..17904
[7] DH18421..18909
[7] KR19852..20394
[7] ACP20698..20910

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [748-867]  1.2e-74 G3DSA:3.40.366.10 [2467-2582]  9.2e-79 G3DSA:3.40.366.10 [4207-4324]  6e-67 G3DSA:3.40.366.10 [5964-6084]  4e-77 G3DSA:3.40.366.10
G3DSA:3.40.366.10   no description
IPR006162 Phosphopantetheine attachment site (PTM)
 [1688-1703]  PS00012 [3418-3433]  PS00012 [5154-5169]  PS00012 [6928-6943]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1660-1730]  20.595 PS50075 [3390-3460]  21.553 PS50075 [5126-5196]  20.731 PS50075 [6900-6970]  21.94 PS50075
PS50075   ACP_DOMAIN
 [1664-1729]  7.4e-11 PF00550 [3394-3459]  6.8e-12 PF00550 [5130-5195]  7.7e-12 PF00550 [6903-6969]  6.9e-12 PF00550
PF00550   PP-binding
 [1662-1758]  3.3e-19 G3DSA:1.10.1200.10 [3389-3463]  1e-20 G3DSA:1.10.1200.10 [5125-5200]  3.5e-20 G3DSA:1.10.1200.10 [6900-6972]  1.4e-20 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   no description
 [1653-1768]  8.7e-29 SSF47336 [3383-3499]  2.2e-27 SSF47336 [5119-5235]  6.3e-28 SSF47336 [6892-6987]  3.3e-23 SSF47336
SSF47336   ACP-like
IPR013968 Polyketide synthase, KR (Domain)
 [1380-1559]  4.5e-65 PF08659 [3109-3287]  1.8e-64 PF08659 [4846-5025]  8.4e-65 PF08659 [6618-6797]  5.8e-66 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [33-283]  9.5e-94 PF00109 [1751-2002]  1.4e-99 PF00109 [3482-3733]  7.8e-99 PF00109 [5219-5469]  1.5e-91 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [291-409]  1.5e-47 PF02801 [2010-2128]  2.5e-48 PF02801 [3741-3859]  2e-48 PF02801 [5477-5595]  1.6e-48 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [562-876]  1.7e-63 PF00698 [2281-2591]  5e-62 PF00698 [4019-4336]  7.5e-95 PF00698 [5778-6094]  9.9e-63 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [4-29]  7.2e-08 PF08990
PF08990   Docking
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [558-858]  1.7e-70 SSF52151 [2277-2583]  9.2e-71 SSF52151 [4017-4307]  1.2e-60 SSF52151 [5774-6086]  2.9e-71 SSF52151
SSF52151   FabD/lysophospholipase-like
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [683-747]  1.6e-16 SSF55048 [2402-2466]  2.8e-17 SSF55048 [4142-4207]  1.1e-18 SSF55048 [5899-5963]  4.7e-17 SSF55048
SSF55048   Probable ACP-binding domain of malonyl-CoA ACP transacylase
IPR016038 Thiolase-like, subgroup (Domain)
 [33-294]  5.8e-86 G3DSA:3.40.47.10 [295-464]  4.3e-65 G3DSA:3.40.47.10 [1759-2013]  7.9e-91 G3DSA:3.40.47.10 [2014-2183]  3.2e-65 G3DSA:3.40.47.10 [3485-3745]  1.6e-90 G3DSA:3.40.47.10 [3746-3911]  5e-65 G3DSA:3.40.47.10 [5219-5480]  4.6e-84 G3DSA:3.40.47.10 [5481-5647]  2.9e-64 G3DSA:3.40.47.10
G3DSA:3.40.47.10   no description
IPR016039 Thiolase-like (Domain)
 [25-461]  2.1e-104 SSF53901 [1744-2180]  3.6e-104 SSF53901 [3475-3911]  5.2e-106 SSF53901 [5211-5593]  7.5e-102 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1379-1577]  1.2e-34 G3DSA:3.40.50.720 [3110-3297]  1.5e-35 G3DSA:3.40.50.720 [5089-5090]  2.7e-34 G3DSA:3.40.50.720 [6616-6824]  1.7e-36 G3DSA:3.40.50.720
G3DSA:3.40.50.720   no description
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [196-212]  PS00606 [1915-1931]  PS00606 [3646-3662]  PS00606 [5382-5398]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [562-858]  7.5e-124 SM00827 [2281-2573]  3e-130 SM00827 [4021-4316]  6.2e-109 SM00827 [5778-6076]  1.1e-130 SM00827
SM00827   Acyl transferase domain in polyketide syntha
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1661-1733]  5.6e-30 SM00823 [3391-3463]  4.3e-34 SM00823 [5127-5199]  7.7e-35 SM00823 [6901-6973]  2.8e-30 SM00823
SM00823   Phosphopantetheine attachment site
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [924-1086]  1.9e-75 SM00826 [2639-2802]  7.3e-80 SM00826 [4381-4544]  5.3e-72 SM00826 [6141-6303]  1.9e-79 SM00826
SM00826   no description
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [35-461]  1.1e-219 SM00825 [1754-2180]  4.7e-229 SM00825 [3485-3911]  6.7e-233 SM00825 [5221-5647]  3.4e-218 SM00825
SM00825   Beta-ketoacyl synthase
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1380-1560]  3.8e-64 SM00822 [3109-3289]  3.5e-63 SM00822 [4846-5026]  3.1e-63 SM00822 [6618-6798]  1.3e-64 SM00822
SM00822   no description
SignalP No significant hit
TMHMM No significant hit