close all open/close all

CDS information : Lydi_00120


close this sectionLocation

Organism
StrainTP-A0598 (=NBRC 110027)
Entry nameLydicamycin
Contig
Start / Stop / Direction44,285 / 54,931 / + [in whole cluster]
44,285 / 54,931 / + [in contig]
Location44285..54931 [in whole cluster]
44285..54931 [in contig]
TypeCDS
Length10,647 bp (3,548 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)polyketide synthase
GeneTPA0598_03_00760
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[26380643] Draft genome sequence of marine-derived Streptomyces sp. TP-A0598, a producer of anti-MRSA antibiotic lydicamycins. (Stand Genomic Sci. , 2015)

close this sectionPKS/NRPS Module

8 malonyl-CoA
9 methylmalonyl-CoA
KS31..407
AT566..877
dh923..1083
KR1366..1546
ACP1646..1716
KS1738..2114
AT2274..2590
DH2636..2800
KR3114..3294
ACP3394..3464

close this sectionSequence

selected fasta
>polyketide synthase [polyketide synthase]
MTNDKKLVEYLKQATIDLRQSRRRIWELESEPIAIVGMACRYPGGVASPEDLWTLLSEGR
DGMSAFPADRGWDVEGLYHPDPENPGTSYVREGGFLQNAAEFDPGFFGISPHEALAMDPQ
QRLLLETSWEVFERAGIDPGTLRGSKTGVYAGLMYHNYAARVLDVPDDIASFMSTGAVSS
VVSGRISYLFGFEGPAITVDTACSSSLVALHQAVLALRAGDCDLALAGGVTVMATADTFV
DFSYQRGLAADGRCKPFAAAADGTGWGEGVGLLLVERLSDAQRNGHPVLAVVRGSAVNQD
GASNGLTAPNGPSQQRVIRQALANAHLSPSDVDAVEAHGTGTTLGDPIEAQALLATYGQD
RPADRPLWLGGIKSNLGHTQAAAGVAGIIKMVLAMQHGVLPKTLHLDAPSPHVDWSAGAV
ELLAEARDWPEAERPRRAGVSSFGISGTNAHVVLEQAPADERAEPGPAPVASDPSGLVPW
VLSARSRQALTAQAAGLAAFVDEQPELNPVDTGFSLVTTRAALDHRAVALATDRAGLRTA
VSALAAGDAAPGVLTGLVSDGKLGVLFTGQGAQRLGMGRELYETYPVFARAWDEVCAELD
GLLPRPLTEVVRGGGDLLDQTQYAQAALFALEVALYRWVESRGVAPAVLLGHSIGEVTAA
YLAGVWSLADAAKLVAARGRLMQALPAGGVMASVRASEDEVAPLLEGREQVGIAAVNGPE
SVVVSGAEAEVEQIAAALEREGRKVKRLRVSHAFHSPLMDPMLAEFRAVLSQLTYADAQL
PLISNVTGEPADSAELRNPEYWVRHVREAVRFHDGMRAAHAEGVTTFLELGPDGVLSAMG
QDCLAEDVAFVATLRKDRPEPEVATEALAGLWVRGVPVDWQPMLADGRRVALPTYAFQRQ
HFWLEGDTGAGDMTAAGLGAADHPLLGATVTLPDAVILAGRLSLATHPWLADHAVLGAAV
LPGSALVELAIRAGDQVGCDLIEELTVRRPLVLPERGGVQLRVVVAEPDEDGRRELAVYS
RLEESPEQSWTAHATGALAAGAGAMTFGEAVWPPAGAEALSVDGCYDALGAAGFHHGPVF
QGVQAAWRRGDEIYAEVTLPDEVAADVAKFGLHPALLDAALQPALDGLRLPASWTGVRLH
AVGATALRVKLSRAGDGYALLVADEAGGVVASVDAVRWEPVVPEQLTTSVPGDHHDSLFA
VEWVSLPDLPEASDAEGDDDLVLLHPSVAGGGTTVPDDVRAVTHQVLEQLQSWVADDRNA
AARLVVVTRGAVSVAGEPVDLAMAPLWGLVRSAQSEHPGRFVLIDIDDHETSSAVIHAAV
ATGEAELALREGALSAPRLARLEPSVPSGPSPSGPSGTASVWNPDGTVLITGGTGTLGSL
IARHLVTAHGVRSLLLTSRRGPDAEGAAALREELTALGAQVEIAACDAADRDALAEVLAG
IPADAPLTGVVHTAGVTSDGTLGSLTGESLDTVLRPKMDAAWNLHELTQDADLSAFVLFS
SAAAVLGAAGQGNYATANTFLDTLARHRRNNGLPGTSLAWGLWAETSEITKQLSDTDLRR
MARGGLVPLTAEEGVALFDAALTTDTALSVPIRLDLRALAASGEVAPVLRGLVPVRRRAA
TAGVGAGNALRDRLVGLPQADQDRALRELVTAQVALVLGYAGSGAVEASRAFKDLGFDSL
TAVELRNRMDTATGLSLPATLIFDYPTPAALVRFLREELLGGQTATTVVRSRGAVDDDPI
AIVGMACRFPGGVASPAELWDLLARGEDAVSDFPGDRGWDVERLYHPDPDHHGTSYVREG
GFLRDVADFDPGFFGISPREATAMDPQQRLLLETSWEALEDAGIDPTTLRGADTGVFVGT
NGQDYGSFLAQSSAEVDGHLATGTAGSVVSGRISYTFGFEGPAVTVDTACSSSLVALHWA
IQALRSGECSLALAGGVTIMSTPMEFIEFSRQRALAPNGRSKAFAESADGAGWGEGVGLL
LVERLSDARRNGHPVLAVVRGSAVNQDGASNGLTAPNGPSQQRVIRQALANAGLEASDVD
AVEAHGTGTTLGDPIEAQALLATYGQGRPAERPLWLGSVKSNIGHAQAAAGVAGVMKMVL
AMRHGVLPKTLHVDEPSSHVDWSAGAVELLTEAREWPESGQLRRAGVSSFGISGTNAHVV
LEQAPVEAPVEAPAEPVEEARPGVLPWVLSARSERALAAQAGRLASFVEDRKESDPVDVG
FSLLSTRAGLEYRAVVLGADGADLLDGLRGLAAGVDPAGVVRGSTGTGAGGRVVLVFPGQ
GSQWLGMADELLANSPVFAGRMAECGEALSEFVSWKLDEVLSDEDALARVDVVQPVLWAV
MVSLAAVWEDCGVVPAAVVGHSQGEIAAACVAGILSLRDGARVVALRSQAIGRVLAGRGG
MVSVAGSREAVQERIARWGERVSVAAINGPASTVVSGEPEALQELLAECAEQDVRARQIP
VDYASHGPQVEELREELATVLAEVRPGQGRIPFYSAVNASPISGEELDAAYWFENLRNPV
RFEEAVQALLADGHGVFVECSAHPVLTPGIEDTAQESGTPVVVTGTLRRDEGGWPRFAES
LAQLWAHGVPVDWSTLLPTGRRTDLPTYAFQRQRYWLSASAGTQDAAGLGLRPVEHPLVP
AAVPMAGTDTVVLTGRISTATHPWIADHTVRGVTILPGTGFVDLAIRAGDQVGCPRVEEL
VLEAPLILSDQGGVQLQVSVGAPDDQGRRPVTVHSRADDALDGEPWTGHATGLLGPDTAA
DSGTGLDVWPPKGATPVDLDGIYDQLAAAGVDYGPVFQGLREVWRQGDDLYAEVTLPQDQ
RDEAERFGLHPALLDSVLHALSWSPLAEQDGGPWMPFTWNGVSLFATGATTLRARLSTAP
TGAVTLDIADGLGEPIASVDALRLRAVTATALTGAAPRDTLFRPEWTALHGPKFTGSWAV
LGAERRGLTAAFTGNGDTYTDLAALTAAVEAGAPVPEVVLIAAPRSDRDGFLPGVVHGAV
RDALELIQHWLADDRFAASRLVLVTSGAMAAEATDPVTDLPHAAGWGLFRSAQSEHPGRF
VLVDLDEEDSSAAALPEVIGSGEPQAVVRAGTPRAVRLTRVHLAGEAPAFDAQGTVLITG
GTGMIGTLVARHLVTQRGIRHLVLTSRRGAASPGATELRDELAGLGAEVTLAACDAADRT
ALAELLAAVPQAHPLTAVVHAAGVVEDSVVTSLTPGHLDTVLRPKVDAAWNLHELTKDLG
LSAFILFSSAAAHFGNAGQGNYAAANAFLDALAHHRRAQGLPAVSMAWSVWAERVQAADQ
SEEMRAERISAGAMTAELGMVLFDHARRAGEPVLVPIPLDIPAIRALPKDRVPILLHGLM
PGDTRRSAGTEGPGEKGWAERLIAMPADKQRETVLALVRTQVASVLAYESADQVEDHRPF
KDLGFDSLTAVKLRNQLAAAGGLTLPATLVFDHPTPVALAEFLREELVPAEADPSARLLA
ELDRIAAGLPEIAPDAAGRDKITARLRSILWQWDESRNGESPENSDEDFDSATDDELFDA
LDNELGMS
selected fasta
>polyketide synthase [polyketide synthase]
GTGACCAACGACAAGAAACTTGTCGAGTATCTCAAGCAGGCCACAATCGATCTGCGGCAA
AGTCGCCGCCGGATCTGGGAACTCGAATCGGAACCGATCGCCATTGTCGGCATGGCCTGC
CGCTATCCCGGTGGAGTCGCCTCTCCGGAAGACCTGTGGACGCTGTTGTCCGAGGGCCGC
GACGGCATGTCCGCCTTCCCGGCGGACCGGGGCTGGGATGTGGAGGGGCTTTACCACCCC
GACCCGGAAAACCCCGGCACGTCCTATGTCCGGGAGGGCGGATTCCTCCAGAACGCTGCG
GAGTTCGACCCGGGGTTCTTCGGAATCTCACCGCATGAGGCGCTCGCGATGGACCCGCAG
CAGCGGCTGCTCCTGGAAACGTCGTGGGAGGTCTTCGAACGCGCCGGAATCGACCCGGGA
ACCCTGCGGGGAAGCAAGACCGGGGTTTATGCCGGGCTGATGTACCACAACTACGCCGCG
CGGGTCCTCGATGTCCCCGACGACATCGCCAGCTTTATGAGCACCGGCGCGGTGAGCAGT
GTGGTCTCCGGCCGTATCTCCTATCTGTTCGGCTTCGAAGGCCCCGCGATCACCGTGGAC
ACCGCCTGCTCTTCCTCACTGGTGGCGCTGCACCAGGCGGTACTGGCGCTCCGGGCGGGG
GACTGCGACCTCGCGCTGGCCGGTGGCGTGACCGTGATGGCCACCGCGGACACCTTCGTC
GACTTCTCCTACCAGCGCGGTCTCGCGGCGGACGGCCGCTGCAAGCCGTTCGCCGCCGCC
GCGGACGGCACCGGCTGGGGCGAGGGCGTCGGCCTGCTGCTGGTGGAGCGGCTCTCCGAT
GCCCAGCGCAACGGCCACCCGGTGCTCGCGGTGGTGCGGGGTTCGGCGGTGAACCAGGAC
GGTGCGTCCAACGGTCTGACCGCCCCCAACGGACCCTCGCAGCAGCGGGTGATCCGGCAG
GCTCTCGCCAACGCTCATCTCTCGCCGTCGGATGTGGACGCGGTGGAGGCCCACGGCACC
GGTACGACCCTGGGCGACCCCATCGAGGCCCAGGCGCTGCTGGCGACCTACGGGCAGGAC
CGCCCGGCGGACCGCCCGCTGTGGCTGGGCGGTATCAAGTCCAACCTCGGGCACACCCAG
GCCGCCGCCGGAGTCGCCGGCATCATCAAGATGGTGCTCGCCATGCAGCACGGCGTGCTG
CCCAAGACCCTGCATCTGGACGCCCCTTCACCCCATGTGGACTGGTCCGCCGGCGCGGTG
GAACTCCTCGCCGAAGCCAGGGACTGGCCGGAGGCCGAGCGGCCCCGCCGGGCCGGGGTG
TCCTCCTTCGGCATCAGCGGCACCAACGCCCATGTCGTCCTCGAACAGGCCCCCGCCGAC
GAACGCGCAGAGCCCGGCCCCGCCCCCGTGGCATCCGATCCGTCCGGTCTGGTGCCCTGG
GTGCTGTCCGCCCGTTCCCGGCAGGCACTCACCGCACAGGCGGCCGGACTCGCCGCCTTC
GTGGACGAGCAGCCGGAGCTGAACCCCGTGGACACCGGCTTCTCGCTGGTCACCACGCGT
GCCGCCCTCGACCATCGCGCGGTCGCCCTGGCCACCGACCGGGCCGGACTGCGCACCGCG
GTGTCCGCCCTGGCCGCCGGTGACGCCGCGCCCGGCGTGCTCACCGGACTGGTCAGCGAC
GGCAAACTCGGTGTGCTGTTCACCGGTCAGGGGGCGCAGCGGCTGGGGATGGGCCGTGAG
TTGTATGAGACCTATCCGGTGTTCGCGCGGGCCTGGGATGAGGTGTGTGCGGAGCTGGAC
GGTCTGCTGCCTCGGCCGCTGACGGAGGTGGTCCGGGGCGGGGGTGATCTGCTCGATCAG
ACGCAGTATGCGCAGGCGGCGCTGTTCGCGCTGGAGGTGGCGCTGTATCGGTGGGTGGAG
TCGCGTGGTGTGGCTCCGGCTGTGTTGCTGGGGCATTCCATCGGTGAAGTGACGGCTGCC
TATTTGGCGGGTGTGTGGTCGCTGGCGGATGCGGCGAAGCTGGTGGCGGCTCGTGGGCGG
CTGATGCAGGCTCTGCCGGCCGGTGGTGTCATGGCGTCGGTGCGGGCCTCGGAGGACGAG
GTCGCCCCGCTGCTGGAGGGCCGGGAGCAGGTCGGGATCGCTGCCGTCAATGGCCCCGAG
TCCGTCGTGGTCTCCGGTGCCGAGGCCGAGGTGGAGCAGATCGCTGCTGCCCTGGAGCGG
GAGGGGCGTAAGGTCAAGCGGCTGCGGGTGAGCCATGCCTTCCACTCGCCGCTGATGGAC
CCGATGCTGGCCGAGTTCCGCGCGGTGCTGAGTCAACTCACGTACGCGGACGCTCAGTTG
CCGCTGATCTCGAACGTGACCGGTGAGCCGGCCGACTCGGCCGAACTCCGCAACCCCGAG
TACTGGGTCCGGCACGTCCGGGAAGCCGTCCGCTTCCACGACGGTATGCGCGCCGCCCAC
GCCGAAGGCGTCACCACCTTCCTCGAACTCGGCCCGGACGGCGTCCTGTCCGCCATGGGA
CAGGACTGCCTGGCGGAGGATGTGGCCTTCGTCGCCACGCTGCGCAAGGACCGTCCCGAA
CCCGAGGTGGCGACGGAGGCTCTCGCCGGGCTGTGGGTCCGTGGGGTCCCCGTCGACTGG
CAGCCGATGCTCGCCGACGGCCGCCGGGTGGCACTGCCGACGTACGCCTTCCAGCGGCAG
CACTTCTGGCTGGAAGGCGACACCGGGGCCGGCGATATGACCGCCGCGGGTCTGGGCGCT
GCCGATCACCCGCTGCTCGGTGCCACCGTGACCCTGCCGGACGCCGTGATCCTGGCCGGC
CGGCTGTCCCTGGCCACCCACCCCTGGCTCGCCGACCATGCCGTACTCGGCGCCGCCGTA
CTGCCCGGCTCCGCCCTGGTCGAACTCGCCATCCGGGCCGGGGACCAGGTCGGCTGCGAC
CTGATCGAAGAACTCACCGTGCGCAGGCCACTGGTGCTGCCGGAGCGTGGCGGAGTCCAG
CTGCGCGTCGTCGTCGCGGAGCCCGACGAGGACGGCCGCCGGGAACTGGCGGTGTACTCG
CGGCTTGAGGAGTCCCCCGAACAGTCCTGGACCGCGCACGCGACGGGTGCGCTGGCGGCG
GGCGCCGGGGCGATGACGTTCGGCGAAGCGGTCTGGCCGCCGGCCGGCGCCGAGGCCCTC
TCCGTGGACGGCTGCTATGACGCTCTCGGTGCCGCCGGATTCCACCACGGCCCCGTGTTC
CAGGGTGTCCAGGCCGCCTGGCGGCGTGGCGACGAGATCTACGCCGAGGTCACCCTGCCG
GACGAAGTCGCCGCCGATGTCGCGAAGTTCGGGCTGCATCCGGCCCTGCTGGACGCCGCG
CTGCAACCAGCGCTCGACGGGCTGCGGCTCCCCGCGTCCTGGACCGGGGTGCGCCTGCAC
GCAGTGGGTGCCACCGCACTCCGGGTGAAGCTGAGCAGGGCAGGTGACGGGTATGCGCTC
CTCGTCGCCGATGAGGCCGGCGGCGTGGTCGCCTCCGTAGACGCGGTGCGCTGGGAGCCG
GTGGTTCCCGAGCAGCTGACCACGAGCGTCCCGGGCGACCACCACGACTCGCTGTTCGCG
GTGGAGTGGGTGTCCCTGCCGGACCTTCCCGAGGCTTCCGACGCCGAGGGCGACGACGAC
CTCGTCCTCCTGCATCCGTCGGTGGCGGGCGGGGGGACGACCGTTCCCGACGATGTGCGT
GCGGTGACCCACCAGGTGCTGGAACAGCTTCAGAGCTGGGTCGCCGATGACCGGAACGCC
GCTGCCCGGCTCGTGGTGGTGACCCGGGGTGCCGTCTCGGTCGCCGGTGAGCCGGTGGAT
CTGGCCATGGCGCCGCTCTGGGGACTGGTGCGCTCGGCGCAGTCGGAGCACCCGGGCCGT
TTCGTACTGATCGATATCGACGACCACGAGACGTCCTCCGCCGTGATCCATGCCGCCGTG
GCCACCGGTGAAGCCGAACTGGCTCTCCGGGAAGGCGCGTTGTCGGCACCTCGGCTCGCC
AGGCTCGAACCGTCCGTACCGTCCGGACCTTCCCCGTCCGGGCCGTCCGGAACGGCCTCG
GTCTGGAACCCCGACGGCACCGTACTGATCACCGGCGGCACCGGAACCCTGGGCAGCCTG
ATCGCCCGGCACCTGGTGACCGCACACGGCGTCCGCAGCCTCCTGCTGACGAGCCGCCGC
GGCCCGGACGCCGAGGGCGCAGCCGCCCTCCGCGAGGAACTCACCGCGCTGGGCGCCCAG
GTGGAGATCGCCGCCTGCGATGCGGCGGATCGCGACGCCCTCGCCGAAGTGCTGGCGGGA
ATCCCGGCGGACGCTCCGCTGACCGGAGTCGTGCACACCGCGGGGGTCACCTCCGACGGA
ACCCTCGGCTCCCTCACCGGGGAAAGCCTGGACACCGTGCTGCGGCCCAAGATGGATGCC
GCCTGGAACCTGCACGAACTCACCCAGGACGCCGATCTCTCCGCGTTCGTCCTCTTCTCG
TCGGCCGCAGCGGTACTCGGCGCGGCCGGACAGGGCAACTACGCCACCGCCAACACCTTC
CTGGACACGCTCGCCCGCCATCGCCGCAACAACGGTCTGCCGGGCACCTCCCTGGCGTGG
GGGCTCTGGGCCGAGACCAGTGAGATCACCAAGCAGCTCAGTGACACCGATCTGCGACGG
ATGGCCCGCGGCGGACTCGTCCCGCTCACCGCGGAGGAAGGCGTGGCACTGTTCGACGCC
GCGCTCACCACGGACACCGCGCTCTCCGTCCCGATACGGCTGGATCTGCGGGCGCTTGCC
GCCTCCGGGGAGGTGGCGCCCGTCCTGCGGGGACTGGTGCCGGTGCGCCGGCGTGCCGCC
ACGGCCGGCGTCGGTGCCGGTAACGCGTTACGGGACCGTCTCGTCGGCCTGCCGCAGGCC
GACCAGGACCGGGCGCTGAGGGAACTGGTCACGGCCCAGGTCGCCCTGGTACTCGGGTAC
GCGGGCAGCGGCGCGGTGGAGGCATCCCGTGCGTTCAAGGACCTCGGGTTCGATTCGCTG
ACCGCGGTGGAACTGCGCAACCGCATGGACACCGCGACCGGACTCAGCCTCCCGGCGACC
CTGATCTTCGACTATCCGACCCCGGCCGCTCTCGTGCGGTTCCTGCGGGAAGAACTGCTC
GGCGGGCAGACCGCCACCACCGTGGTGCGGTCCCGCGGGGCCGTGGACGACGATCCCATC
GCCATCGTCGGAATGGCCTGCCGCTTCCCCGGCGGCGTCGCCTCTCCGGCGGAGCTCTGG
GACCTGCTGGCCCGCGGCGAGGACGCGGTCAGCGACTTCCCCGGCGACCGCGGCTGGGAC
GTCGAGCGGCTCTACCACCCGGACCCCGACCACCACGGCACCTCATACGTCCGAGAAGGC
GGCTTCCTGCGGGACGTGGCCGACTTTGACCCCGGGTTCTTCGGCATCTCACCGCGCGAG
GCGACCGCCATGGACCCGCAGCAGCGGCTGCTGCTGGAAACCTCCTGGGAGGCCCTGGAA
GACGCGGGCATCGACCCGACGACACTGCGCGGTGCCGACACCGGCGTCTTCGTCGGCACC
AACGGCCAGGACTACGGCTCCTTCCTGGCCCAGAGTTCCGCCGAGGTGGACGGCCACCTC
GCCACCGGCACCGCGGGCAGCGTGGTATCCGGCCGGATCTCCTACACCTTCGGCTTCGAG
GGCCCCGCGGTGACGGTCGACACCGCGTGCTCGTCCTCTCTGGTGGCCCTGCACTGGGCC
ATCCAGGCGCTGCGGTCCGGCGAGTGCTCACTGGCCCTGGCCGGCGGTGTGACGATCATG
TCCACACCGATGGAGTTCATCGAGTTCTCCCGCCAGCGCGCCCTCGCTCCGAACGGCCGC
AGCAAGGCCTTCGCGGAGAGCGCGGACGGCGCGGGCTGGGGCGAGGGCGTCGGTCTGCTG
CTGGTCGAGCGCCTTTCGGACGCCCGGCGCAACGGTCACCCGGTGCTAGCGGTGGTGCGG
GGTTCGGCGGTGAACCAGGACGGTGCGTCCAACGGTCTGACCGCCCCCAACGGCCCCTCG
CAGCAGAGGGTGATCCGTCAGGCGCTGGCGAACGCCGGTCTCGAAGCGTCGGATGTGGAC
GCGGTGGAGGCGCACGGCACCGGCACGACGCTGGGCGACCCGATCGAGGCCCAGGCGCTG
CTGGCCACGTATGGGCAGGGACGCCCGGCGGAGCGGCCGTTGTGGCTGGGTTCGGTGAAG
TCGAACATCGGGCACGCCCAGGCCGCGGCCGGGGTGGCCGGTGTGATGAAGATGGTGCTG
GCCATGCGGCACGGTGTGCTGCCGAAGACGCTGCATGTGGATGAGCCGTCGTCGCATGTG
GACTGGTCCGCGGGTGCGGTGGAGCTGCTGACGGAGGCCAGGGAATGGCCGGAGAGTGGT
CAGCTGCGTCGGGCGGGTGTGTCGTCCTTCGGTATCAGCGGGACAAATGCGCATGTGGTA
CTGGAGCAGGCCCCTGTAGAGGCACCTGTAGAGGCACCGGCGGAGCCGGTCGAGGAGGCG
CGGCCCGGGGTTCTGCCGTGGGTGCTCTCCGCACGCTCCGAGCGTGCGTTGGCCGCTCAG
GCCGGCCGGTTGGCGTCCTTTGTCGAGGACCGCAAGGAGTCGGATCCCGTTGATGTGGGG
TTCTCCCTGCTGAGTACCCGGGCGGGGTTGGAGTACCGGGCGGTGGTGCTCGGTGCTGAC
GGTGCGGACCTTCTTGACGGCCTTCGTGGGCTGGCTGCGGGGGTGGATCCCGCGGGTGTG
GTGCGGGGTTCGACCGGTACGGGAGCCGGTGGCCGTGTGGTGCTGGTTTTCCCTGGTCAG
GGCTCGCAGTGGCTGGGCATGGCGGATGAACTGCTCGCCAATTCCCCGGTGTTCGCGGGG
CGGATGGCTGAGTGTGGCGAGGCGCTGTCGGAGTTCGTGTCCTGGAAGTTGGATGAGGTT
CTGTCCGACGAGGACGCGTTGGCGCGGGTTGATGTGGTGCAGCCGGTGCTGTGGGCGGTG
ATGGTGTCGTTGGCTGCGGTCTGGGAGGACTGCGGTGTGGTGCCCGCTGCCGTGGTGGGG
CATTCACAGGGTGAGATCGCCGCGGCCTGTGTCGCCGGCATCTTGTCTCTGCGTGATGGT
GCCCGGGTGGTGGCGTTGCGCAGTCAGGCCATTGGTCGGGTGTTGGCTGGTCGCGGCGGT
ATGGTCTCCGTCGCCGGCTCGCGTGAGGCGGTTCAGGAGCGCATCGCCAGGTGGGGTGAG
CGGGTGTCCGTAGCCGCCATCAACGGCCCGGCATCGACCGTGGTTTCCGGTGAACCCGAA
GCGTTGCAGGAGTTGCTGGCGGAGTGCGCCGAGCAGGACGTACGGGCCCGGCAGATCCCG
GTGGACTACGCCTCCCACGGCCCCCAGGTCGAGGAGCTGCGCGAGGAGCTCGCGACGGTT
CTGGCCGAAGTCCGCCCTGGTCAGGGCCGTATCCCGTTCTACTCCGCGGTGAACGCCTCG
CCCATATCGGGCGAGGAGCTGGACGCCGCCTACTGGTTCGAGAACCTCCGCAACCCCGTA
CGGTTCGAGGAAGCCGTCCAGGCCCTCCTGGCCGACGGCCATGGCGTCTTCGTCGAGTGC
AGCGCACACCCCGTCCTCACCCCTGGCATCGAGGACACGGCGCAGGAGTCCGGCACCCCC
GTCGTCGTCACGGGCACCCTGCGCCGCGACGAAGGCGGCTGGCCCCGCTTCGCGGAATCG
CTCGCCCAACTCTGGGCGCACGGGGTCCCGGTGGACTGGAGCACCCTGCTGCCCACCGGC
CGGCGGACCGACCTCCCCACCTACGCCTTCCAGCGACAGCGCTACTGGCTGTCGGCCTCC
GCGGGTACTCAGGATGCGGCCGGTCTCGGGCTGCGACCGGTGGAGCATCCGCTCGTCCCG
GCCGCCGTTCCCATGGCCGGTACGGACACGGTCGTCCTCACCGGGCGGATCAGTACGGCC
ACCCACCCGTGGATCGCCGACCACACCGTCCGGGGCGTCACCATCCTCCCCGGCACCGGC
TTTGTGGACCTTGCCATCAGGGCGGGTGACCAGGTCGGCTGTCCCAGGGTCGAGGAACTC
GTGCTGGAGGCCCCGCTGATCCTCTCGGATCAGGGTGGGGTGCAGCTCCAGGTCAGCGTC
GGCGCTCCGGACGATCAGGGCCGCCGACCGGTCACGGTGCACTCGCGCGCCGACGACGCG
CTCGACGGTGAGCCATGGACCGGGCATGCCACCGGGCTTCTCGGACCGGACACCGCCGCC
GACAGTGGAACCGGCCTCGACGTGTGGCCCCCTAAGGGAGCCACCCCGGTGGACCTGGAC
GGCATTTACGACCAGCTGGCCGCCGCCGGAGTGGACTACGGGCCCGTGTTCCAGGGCCTG
CGGGAGGTCTGGCGTCAGGGTGACGACCTCTACGCGGAGGTGACCCTTCCGCAGGACCAG
CGGGACGAAGCCGAGCGGTTCGGGCTGCACCCGGCCCTGCTCGACTCCGTACTGCACGCC
CTGTCGTGGTCCCCGCTCGCGGAGCAGGACGGTGGTCCCTGGATGCCCTTCACCTGGAAC
GGCGTCTCGCTCTTCGCGACCGGGGCGACCACCCTGCGGGCCCGCCTCAGCACCGCGCCG
ACCGGGGCCGTGACGCTGGATATCGCTGACGGCCTCGGTGAGCCCATCGCCTCCGTCGAC
GCGCTGCGGCTCCGGGCCGTCACCGCCACCGCACTGACCGGCGCCGCACCGCGCGACACC
CTCTTCCGCCCCGAGTGGACGGCCCTCCACGGGCCGAAGTTCACCGGCTCCTGGGCCGTG
CTCGGTGCGGAACGACGGGGCCTGACGGCCGCGTTCACGGGGAACGGCGACACCTACACC
GATCTCGCCGCGCTCACCGCGGCGGTCGAGGCGGGCGCGCCCGTCCCCGAGGTCGTCCTG
ATCGCCGCACCGCGCAGCGACCGGGACGGATTCCTCCCGGGGGTGGTACACGGCGCCGTG
CGCGACGCCCTGGAACTCATCCAGCACTGGCTGGCCGACGACCGGTTCGCCGCCTCCCGT
CTGGTGCTGGTGACGAGCGGGGCCATGGCGGCCGAGGCCACCGACCCGGTGACCGACCTG
CCACATGCCGCCGGCTGGGGGCTGTTCCGGTCCGCCCAGTCCGAGCATCCCGGGCGGTTC
GTCCTCGTCGACCTGGACGAGGAGGACTCCTCGGCCGCCGCCCTGCCGGAGGTCATCGGC
TCCGGCGAGCCACAGGCCGTCGTCCGGGCCGGCACGCCCCGCGCCGTGCGGCTCACAAGG
GTCCACCTGGCCGGCGAGGCCCCGGCCTTCGACGCACAGGGCACGGTGCTGATCACCGGC
GGTACGGGAATGATCGGCACCCTGGTGGCCCGTCATCTGGTGACACAGCGCGGGATACGT
CATCTGGTGCTCACCAGCCGCCGTGGCGCGGCGAGCCCGGGGGCCACGGAACTGCGGGAC
GAGCTGGCCGGGCTCGGGGCGGAAGTCACCCTTGCCGCCTGCGACGCCGCAGACCGGACC
GCGTTGGCGGAGCTGCTGGCGGCTGTTCCGCAGGCCCATCCGCTGACCGCGGTCGTGCAC
GCGGCAGGGGTGGTCGAGGACAGTGTGGTCACCTCGCTCACCCCGGGGCATCTGGACACC
GTGCTGCGGCCCAAGGTGGACGCGGCCTGGAACCTGCATGAGCTCACCAAGGATCTGGGC
CTGTCGGCGTTCATCCTGTTCTCCTCGGCGGCCGCGCACTTCGGCAACGCAGGGCAGGGC
AACTACGCCGCCGCCAACGCCTTCTTGGACGCACTCGCACACCACCGGCGCGCCCAGGGC
CTGCCCGCCGTCTCGATGGCCTGGAGCGTCTGGGCCGAGCGGGTCCAAGCCGCGGACCAG
AGCGAGGAGATGCGGGCGGAGCGGATCTCGGCGGGAGCGATGACCGCGGAACTCGGCATG
GTCCTCTTCGACCACGCCCGCCGGGCCGGCGAACCGGTGCTGGTGCCGATTCCGCTGGAC
ATCCCGGCGATCCGGGCCCTGCCGAAGGACCGGGTACCGATCCTGCTGCACGGTCTGATG
CCCGGCGACACCCGGCGGTCGGCCGGCACCGAGGGACCGGGCGAGAAGGGCTGGGCAGAG
CGGCTGATCGCCATGCCGGCGGACAAACAGCGGGAGACCGTGCTGGCCCTGGTGCGTACC
CAGGTCGCGTCGGTACTCGCCTACGAGTCCGCCGATCAGGTCGAGGACCACCGGCCGTTC
AAGGACCTGGGGTTCGACTCGCTGACCGCGGTGAAACTGCGCAATCAGCTGGCCGCGGCC
GGTGGCCTGACCCTGCCCGCCACCCTGGTCTTCGACCATCCGACCCCGGTCGCGCTCGCC
GAGTTCCTGCGGGAGGAGCTGGTGCCGGCCGAGGCGGACCCCTCGGCCCGGCTGCTCGCC
GAACTCGACCGGATCGCCGCCGGACTGCCGGAGATCGCCCCCGACGCCGCCGGCCGGGAC
AAGATCACCGCTCGGCTGCGCAGCATCTTGTGGCAGTGGGACGAGAGCAGGAACGGCGAG
AGTCCGGAGAACTCCGACGAGGACTTCGACTCAGCCACCGATGACGAACTCTTCGACGCT
CTCGATAACGAACTCGGAATGTCCTAA
[8] KS31..407
[8] AT566..877
[8] malonyl-CoA752..756
[8] dh923..1083
[8] KR1366..1546
[8] ACP1646..1716
[9] KS1738..2114
[9] AT2274..2590
[9] methylmalonyl-CoA2463..2467
[9] DH2636..2800
[9] KR3114..3294
[9] ACP3394..3464
[8] KS91..1221
[8] AT1696..2631
[8] malonyl-CoA2254..2268
[8] dh2767..3249
[8] KR4096..4638
[8] ACP4936..5148
[9] KS5212..6342
[9] AT6820..7770
[9] methylmalonyl-CoA7387..7401
[9] DH7906..8400
[9] KR9340..9882
[9] ACP10180..10392

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [752-865]  8.7e-78 G3DSA:3.40.366.10 [2462-2579]  2.9e-69 G3DSA:3.40.366.10
G3DSA:3.40.366.10   no description
IPR006162 Phosphopantetheine attachment site (PTM)
 [1674-1689]  PS00012 [3422-3437]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1646-1716]  20.96 PS50075 [3394-3464]  20.138 PS50075
PS50075   ACP_DOMAIN
 [1650-1715]  4.2e-10 PF00550 [3398-3463]  1.9e-11 PF00550
PF00550   PP-binding
 [1645-1719]  2.6e-19 G3DSA:1.10.1200.10 [3391-3467]  6.5e-20 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   no description
 [1639-1754]  2.1e-26 SSF47336 [3385-3471]  3e-21 SSF47336
SSF47336   ACP-like
IPR013968 Polyketide synthase, KR (Domain)
 [1366-1545]  1.4e-62 PF08659 [3114-3293]  1.4e-63 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [31-281]  8.3e-97 PF00109 [1738-1988]  8.4e-102 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [289-407]  1.2e-48 PF02801 [1996-2114]  4.2e-50 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [566-877]  1.5e-63 PF00698 [2274-2590]  5.8e-99 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [1-27]  2.9e-10 PF08990
PF08990   Docking
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [562-846]  1.4e-69 SSF52151 [2272-2562]  8.8e-64 SSF52151
SSF52151   FabD/lysophospholipase-like
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [687-751]  4e-17 SSF55048 [2397-2462]  2e-19 SSF55048
SSF55048   Probable ACP-binding domain of malonyl-CoA ACP transacylase
IPR016038 Thiolase-like, subgroup (Domain)
 [31-292]  6.9e-88 G3DSA:3.40.47.10 [293-460]  3.7e-65 G3DSA:3.40.47.10 [1738-1999]  1.7e-92 G3DSA:3.40.47.10 [2000-2166]  4e-66 G3DSA:3.40.47.10
G3DSA:3.40.47.10   no description
IPR016039 Thiolase-like (Domain)
 [23-405]  5.6e-105 SSF53901 [1730-2163]  2.4e-106 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1366-1583]  4e-34 G3DSA:3.40.50.720 [3114-3300]  3.9e-33 G3DSA:3.40.50.720
G3DSA:3.40.50.720   no description
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [194-210]  PS00606 [1901-1917]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [566-858]  3.3e-126 SM00827 [2276-2571]  9.5e-113 SM00827
SM00827   Acyl transferase domain in polyketide syntha
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1647-1719]  1.2e-30 SM00823 [3395-3467]  7.8e-30 SM00823
SM00823   Phosphopantetheine attachment site
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [923-1083]  3.3e-74 SM00826 [2636-2800]  5.4e-83 SM00826
SM00826   no description
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [33-459]  9.4e-224 SM00825 [1740-2166]  4.5e-233 SM00825
SM00825   Beta-ketoacyl synthase
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1366-1546]  5e-58 SM00822 [3114-3294]  1.1e-63 SM00822
SM00822   no description
SignalP No significant hit
TMHMM No significant hit