close all open/close all

CDS information : Lydi_00130


close this sectionLocation

Organism
StrainTP-A0598 (=NBRC 110027)
Entry nameLydicamycin
Contig
Start / Stop / Direction54,978 / 60,518 / + [in whole cluster]
54,978 / 60,518 / + [in contig]
Location54978..60518 [in whole cluster]
54978..60518 [in contig]
TypeCDS
Length5,541 bp (1,846 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)polyketide synthase
GeneTPA0598_03_00770
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[26380643] Draft genome sequence of marine-derived Streptomyces sp. TP-A0598, a producer of anti-MRSA antibiotic lydicamycins. (Stand Genomic Sci. , 2015)

close this sectionPKS/NRPS Module

10 methylmalonyl-CoA
KS34..410
AT576..891
dh937..1098
KR1404..1584
ACP1687..1757

close this sectionSequence

selected fasta
>polyketide synthase [polyketide synthase]
MENEAKLRDYLKRATADLRRTRQRLREVEEKQHEPIAIIGMACRYPGGVSSPEELWQLVA
DGRDAVTTFPDNRGWDLESLHDPDSGRPYTSYVREGGFLHDALEFDPEMFGISPHEASAM
DPQQRLLLEASWEAFEHAGIDPMALRGSSTGVFAGLMYHEYASRLNHVAPEAAGFLGTGS
IGSVLSGRISYSFGLEGPAVTVDTACSSSLVALHLAIQALRTGECSLALAGGVTVMSTPD
TFIDFSRQQNLARNGRCKAFASGADGTTLAEGAGMLLVERLSDAERHGHPILAVVRGSAV
NQDGASNGLTAPNGPSQQRVVEQALANARLSADQVDAVEAHGTGTALGDPIEAQALLATY
GQGRPAERPLWLGSVKSNLGHTQAAAGVAGVMKMVLAMRHGVLPKTLHVDEPSSHVNWAA
GAVELLTEAREWPESGQLRRAGVSSFGISGTNAHVVLEQAPPASEPEAVETADDEPVEAA
ARAGVVPWVLSARSEQALSAQAERLASFVAEHPELDATDVGFSLLSTRAGLEYRAVVLGA
DREESLSGVRGLAGGLDPAGVVRGSTGTGAGSRVALVFPGQGSQWLGMADQLLATSPVFA
GRMAECGAALSEFVPWKLDEVLSDEDALARVDVVQPVLWAVMVSLAAVWEDCGVVPAAVV
GHSQGEIAAACVAGILSLRDGARVVALRSQAIGRVLAGRGGMVSVAGSREAVQERIAKWG
ERVSVAAINGPASTVVSGEPEALRELLAECAEQDVRARQIPVDYASHGAQVEELREELAT
VLAEVAPAEGRIPFYSAVNASVVSGEELDAGYWFENLRNTVRFEEAIQALFADGHGVFVE
CSAHPVLTPGIEDTAQEAGSPVVVTGSLRRDEGGWPRFAQSLAQLWAHGVPVDWSTLLPT
GRRTDLPTYAFQRQRYWLDDTGTVGDVTAAGLSSADHPLLGAAVSMPGTQVLTGRLSQTS
HPWLAERIVLNTAVVPESALVDLAIRAGDQVGCDLVRELTVEIPLVLPEHAAVLLRVLVA
EPDADGGREISVYSRPEDVPDEQAWTRHATGVLARSAEPAGFDAQSWPPTDAAPVELADF
YRERAELGLGYGPVFQGLRAVWRRGGELFAEVALPEGDTGDTSGFGLHPALLDAALQCAG
PDGAQLPLAWTGVSLHAVGATALRVALTPAGDGYAVRIADVEGAPVASIASVTWDDVPAE
RLAEGSGRRGSLYGVDWVAPDPAPAAAPVDPEGTSLVVLGGDGLGVGTAPGGDFLDLEAL
KALDPTPEVVVLPVPDSGVVGVSGGVREVAYGVLETLRAWLAEERFAGSRLVILTRSAVS
VTGEEVDLVTAPVWGLVRSAQSENPDHFVLVDSDDRQASRAALMAAVALGEPQVAIRDGE
LAVPRLTTLEPFEKDGAPVWKPEGTVLITGGTGTLGTLVARHLVTEHRVQNLLLTSRRGP
DAEGADALREELTALGARVTIAACDTADRDALAGLLAGIPAEAPLTGVVHTAGVLDDGVL
GSLTRERIDAVLRPKVDAAWNLHELTKELDLSAFVLFSSAAGVFGAPGQGNYATANAFLD
ALAAYRRAQALPAESLAWGLWEESSGLTGTLSEADRQRKARDGLRPMSSAEALALFDASV
AGERALTVPVRFDLTALGVGLRTDEVPPLLRRLVRGTRRSAAAGQGGADGLPERLRTASP
AQRSRLLLNLVRGHVVAVLGYADADAVEAGKAFKDLGFDSLTAVELRNRLNRDTGLKLPA
TTIFDYPNSRVLAEYLGTHFAPYGDAGSGADDNEETIRRMLTSIPLNRLAEAGLMSSLLE
LAGITEEASETTEDDDRESLDTMDMEAMIQLALDGSGAEDDMTRGL
selected fasta
>polyketide synthase [polyketide synthase]
ATGGAGAATGAAGCCAAACTCCGGGATTATCTCAAGCGAGCTACGGCTGATCTCCGCCGC
ACGCGCCAGAGGTTGCGCGAGGTCGAGGAGAAGCAGCACGAGCCGATCGCCATCATCGGC
ATGGCCTGCCGGTATCCGGGAGGAGTGAGTTCACCCGAGGAACTCTGGCAGCTGGTGGCC
GACGGCCGGGACGCCGTCACCACCTTCCCGGACAACCGGGGCTGGGACCTGGAATCCCTG
CACGACCCGGATTCCGGGCGCCCCTACACCTCTTATGTCCGCGAGGGCGGATTCCTGCAT
GACGCCCTCGAATTCGACCCCGAAATGTTCGGCATTTCCCCGCATGAGGCCTCCGCCATG
GACCCCCAGCAGCGGCTGCTGCTGGAGGCGTCCTGGGAGGCGTTCGAGCATGCGGGAATC
GACCCGATGGCCCTGCGCGGCAGTTCCACCGGGGTGTTCGCCGGGCTGATGTATCACGAG
TACGCGTCGCGGCTGAACCATGTCGCCCCCGAAGCCGCGGGCTTCCTCGGCACCGGGAGC
ATCGGCAGCGTGCTGTCGGGCCGGATCTCGTACTCCTTCGGCCTGGAGGGCCCGGCGGTG
ACCGTGGACACCGCCTGCTCGTCCTCCCTGGTGGCCCTGCATCTGGCGATCCAGGCACTG
CGGACCGGGGAGTGCTCACTGGCCCTGGCCGGCGGGGTCACCGTGATGTCCACCCCCGAT
ACGTTCATCGACTTCTCCCGTCAGCAGAACCTGGCACGCAATGGGCGCTGCAAGGCATTC
GCCTCGGGCGCGGACGGCACCACCCTCGCCGAGGGCGCCGGAATGCTGCTGGTGGAGCGG
CTGTCGGACGCCGAGCGCCACGGCCATCCGATCCTCGCGGTGGTGCGGGGTTCGGCGGTG
AACCAAGACGGTGCGTCCAACGGTCTCACCGCCCCCAACGGCCCCTCCCAGCAGCGCGTC
GTGGAGCAGGCCCTGGCGAACGCCCGGCTCTCCGCCGATCAGGTCGACGCGGTGGAGGCA
CACGGCACCGGCACCGCCCTCGGCGACCCCATCGAGGCGCAGGCGCTGCTGGCCACGTAC
GGCCAGGGACGCCCGGCGGAGCGGCCGTTGTGGCTGGGTTCGGTGAAGTCGAACCTCGGA
CATACCCAGGCCGCGGCCGGGGTGGCCGGTGTGATGAAGATGGTGCTGGCCATGCGGCAC
GGTGTGCTGCCGAAGACGCTGCATGTGGATGAGCCGTCGTCGCATGTGAATTGGGCCGCG
GGTGCGGTGGAGCTGCTGACGGAGGCCAGGGAGTGGCCCGAGAGTGGGCAGCTGCGTCGG
GCGGGTGTGTCGTCCTTCGGCATCAGCGGGACGAACGCACACGTCGTGCTGGAGCAGGCA
CCTCCCGCCTCTGAGCCGGAGGCCGTGGAAACGGCTGACGACGAGCCGGTTGAGGCGGCG
GCGCGGGCAGGGGTGGTGCCGTGGGTGCTGTCGGCGCGTTCGGAGCAGGCGTTGTCGGCT
CAGGCGGAGCGCTTGGCGTCCTTCGTGGCGGAGCACCCCGAGCTGGACGCAACTGACGTG
GGATTCTCCCTGCTGAGCACGCGAGCGGGGTTGGAGTACCGGGCGGTGGTCCTCGGCGCT
GACCGGGAGGAGTCGCTCTCCGGAGTTCGTGGACTGGCTGGGGGGCTGGACCCGGCGGGC
GTGGTGCGGGGTTCGACCGGTACGGGAGCCGGTAGCCGTGTGGCGCTGGTGTTCCCTGGT
CAGGGTTCGCAGTGGCTGGGGATGGCGGACCAACTGCTGGCTACTTCCCCGGTGTTCGCG
GGGCGGATGGCTGAGTGTGGTGCGGCGCTTTCGGAGTTCGTGCCCTGGAAGTTGGACGAG
GTGCTGTCCGACGAGGACGCGTTGGCGCGCGTTGATGTGGTGCAGCCGGTGCTGTGGGCG
GTGATGGTGTCGCTGGCTGCGGTCTGGGAGGACTGCGGTGTGGTGCCCGCTGCCGTGGTG
GGTCATTCGCAGGGTGAGATCGCCGCGGCCTGCGTCGCCGGGATTCTGTCGTTGCGTGAT
GGTGCCCGGGTGGTGGCGTTGCGCAGTCAGGCCATCGGCCGTGTCCTGGCTGGTCGCGGC
GGCATGGTGTCGGTCGCCGGCTCGCGCGAGGCCGTGCAGGAGCGCATCGCCAAGTGGGGC
GAGCGGGTGTCCGTCGCCGCCATCAACGGCCCGGCATCGACCGTCGTTTCAGGTGAACCC
GAGGCCTTGCGGGAGTTGCTGGCGGAGTGCGCCGAGCAGGACGTACGGGCCCGGCAGATC
CCGGTGGACTACGCCTCGCACGGGGCCCAGGTCGAGGAGCTGCGCGAGGAACTCGCCACC
GTCCTGGCCGAGGTGGCGCCTGCGGAAGGCCGTATCCCGTTCTACTCCGCGGTGAACGCC
TCGGTCGTCTCCGGTGAGGAGCTGGACGCCGGGTACTGGTTCGAGAACCTGCGCAACACC
GTGCGGTTCGAGGAAGCGATCCAGGCCCTCTTTGCGGACGGGCACGGCGTCTTCGTCGAA
TGCAGCGCGCACCCCGTCCTGACCCCGGGCATCGAAGACACCGCGCAGGAGGCAGGCAGC
CCCGTCGTGGTGACGGGATCTCTCCGCCGCGACGAGGGCGGCTGGCCGCGGTTCGCGCAG
TCCCTCGCCCAACTCTGGGCGCACGGCGTCCCGGTGGACTGGAGCACCCTGCTGCCCACC
GGCCGGCGGACCGACCTCCCGACCTACGCCTTCCAGCGACAGCGCTACTGGCTGGACGAC
ACCGGCACCGTCGGCGATGTCACCGCCGCCGGACTGAGCAGCGCCGATCATCCCCTGCTC
GGTGCGGCCGTCTCGATGCCCGGCACTCAGGTGCTCACGGGGCGGCTGTCGCAGACCAGC
CACCCCTGGCTGGCCGAGCGGATCGTCCTCAACACCGCGGTGGTGCCCGAGAGCGCGTTG
GTCGACCTTGCCATCCGGGCCGGGGACCAGGTGGGCTGCGACCTCGTCCGCGAACTCACC
GTGGAGATACCGCTGGTGCTGCCGGAGCATGCTGCCGTGCTGCTGCGGGTGCTGGTCGCG
GAGCCCGACGCGGACGGCGGCCGGGAGATCAGTGTCTACTCGCGGCCGGAGGACGTCCCG
GACGAGCAGGCGTGGACCCGGCATGCGACCGGTGTCCTCGCCCGAAGCGCCGAGCCGGCC
GGCTTTGACGCACAGAGCTGGCCTCCCACGGATGCCGCGCCCGTCGAGCTGGCGGACTTC
TACCGCGAACGGGCCGAGCTGGGGCTGGGCTACGGCCCGGTGTTCCAAGGGCTGCGCGCG
GTCTGGCGGCGCGGTGGTGAGCTGTTCGCCGAGGTGGCCCTGCCCGAGGGGGACACGGGT
GACACGAGCGGCTTCGGGCTGCATCCGGCACTGCTTGATGCGGCGCTGCAATGCGCCGGG
CCGGACGGGGCGCAACTGCCGCTCGCCTGGACGGGGGTGAGCCTGCATGCCGTAGGGGCG
ACCGCACTGCGGGTGGCGCTGACCCCGGCCGGGGACGGGTACGCCGTTCGGATCGCGGAC
GTCGAGGGCGCTCCCGTCGCCTCCATCGCCTCCGTGACCTGGGATGACGTGCCGGCGGAA
CGGCTCGCCGAAGGTTCCGGCCGCCGCGGATCGCTGTACGGGGTGGACTGGGTGGCCCCG
GACCCGGCCCCGGCCGCGGCGCCAGTGGACCCCGAGGGGACTTCCCTGGTGGTGCTCGGG
GGCGACGGGCTAGGGGTTGGTACGGCACCGGGTGGCGACTTCCTGGACCTGGAAGCCCTG
AAGGCGCTCGATCCGACCCCGGAAGTAGTGGTTCTCCCGGTACCCGACTCAGGGGTTGTC
GGGGTTTCCGGTGGGGTTCGGGAGGTCGCATATGGGGTGTTGGAGACGCTGCGGGCCTGG
TTGGCTGAAGAACGGTTCGCCGGGTCGCGGTTGGTGATTCTGACCCGGAGCGCGGTGTCT
GTGACGGGGGAGGAAGTAGATCTGGTGACGGCACCGGTATGGGGGTTGGTGCGTTCGGCA
CAGTCGGAGAACCCGGATCATTTCGTGCTGGTCGACAGCGATGACCGGCAGGCGTCGCGC
GCTGCGCTGATGGCGGCCGTCGCCCTGGGCGAGCCTCAAGTGGCCATCCGTGACGGCGAG
TTGGCGGTGCCGCGGCTCACCACGCTGGAGCCGTTCGAGAAGGACGGCGCACCGGTGTGG
AAGCCGGAGGGCACCGTGCTCATCACCGGTGGTACCGGCACCCTGGGCACGCTGGTCGCC
CGGCATCTGGTCACCGAGCATCGGGTGCAAAACCTGCTGCTGACCAGCCGCCGCGGCCCG
GACGCCGAGGGGGCCGACGCCCTCCGGGAGGAGCTCACCGCTCTGGGGGCCCGGGTGACC
ATCGCCGCCTGTGACACCGCCGACCGGGACGCGCTGGCCGGACTGCTCGCCGGTATCCCG
GCGGAGGCTCCGCTGACCGGTGTCGTGCACACCGCGGGCGTGCTGGACGACGGCGTCCTC
GGGTCCCTGACCCGGGAGCGGATCGACGCGGTACTGCGGCCGAAGGTGGACGCCGCCTGG
AATCTGCACGAGCTCACCAAGGAGCTCGACCTGTCCGCCTTCGTGCTGTTCTCCTCGGCC
GCCGGGGTGTTCGGCGCACCGGGGCAGGGCAACTACGCCACCGCCAATGCATTCCTGGAC
GCGCTCGCCGCATACCGTCGCGCCCAGGCGCTGCCTGCCGAGTCCCTGGCCTGGGGGCTG
TGGGAGGAGAGCAGCGGGCTGACCGGCACGCTCAGCGAGGCCGACCGGCAGCGTAAGGCC
CGGGACGGGCTGCGTCCGATGTCCTCGGCGGAGGCGCTGGCGCTGTTCGACGCCTCGGTC
GCGGGGGAACGGGCGCTCACCGTGCCGGTCCGGTTCGATCTCACGGCGCTCGGCGTGGGC
TTGCGTACCGACGAGGTTCCCCCGCTGCTGCGCCGGCTGGTCCGCGGCACCCGGCGCAGC
GCCGCGGCCGGCCAGGGCGGTGCGGACGGTCTGCCGGAGCGGCTGAGGACCGCCTCCCCG
GCGCAGCGGTCGCGTCTGCTGCTGAACCTGGTGCGTGGCCATGTGGTCGCCGTACTGGGT
TACGCCGACGCGGACGCGGTGGAAGCGGGCAAGGCCTTCAAGGACCTGGGGTTCGATTCG
CTGACCGCCGTGGAGCTGCGGAACCGGCTCAACCGGGACACCGGGCTGAAACTCCCGGCG
ACCACGATCTTCGACTACCCCAACTCGCGGGTGCTCGCCGAATACCTCGGCACGCACTTC
GCGCCGTACGGGGACGCCGGCTCCGGTGCCGACGACAACGAGGAGACCATCCGCCGGATG
CTGACCTCGATTCCGCTGAACCGTCTCGCCGAGGCCGGGCTGATGAGCTCCCTGCTGGAA
CTGGCCGGGATCACCGAGGAAGCGTCCGAGACCACCGAAGACGACGACCGCGAATCGCTC
GACACGATGGACATGGAAGCCATGATCCAGCTCGCGCTCGACGGTTCCGGCGCCGAAGAC
GACATGACGCGAGGACTGTGA
[10] KS34..410
[10] AT576..891
[10] methylmalonyl-CoA764..768
[10] dh937..1098
[10] KR1404..1584
[10] ACP1687..1757
[10] KS100..1230
[10] AT1726..2673
[10] methylmalonyl-CoA2290..2304
[10] dh2809..3294
[10] KR4210..4752
[10] ACP5059..5271

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [763-880]  4.8e-67 G3DSA:3.40.366.10
G3DSA:3.40.366.10   no description
IPR006162 Phosphopantetheine attachment site (PTM)
 [1715-1730]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1691-1756]  2.4e-11 PF00550
PF00550   PP-binding
 [1679-1774]  4e-21 SSF47336
SSF47336   ACP-like
 [1687-1759]  7.5e-19 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   no description
 [1687-1757]  21.279 PS50075
PS50075   ACP_DOMAIN
IPR013968 Polyketide synthase, KR (Domain)
 [1404-1583]  4.9e-64 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [34-284]  5.2e-97 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [292-410]  5.4e-49 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [576-891]  2.5e-97 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [4-34]  4e-07 SSF101173
SSF101173   Docking domain B of the erythromycin polyketide synthase (DEBS)
 [1-27]  4.4e-13 PF08990
PF08990   Docking
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [573-873]  1.1e-61 SSF52151
SSF52151   FabD/lysophospholipase-like
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [698-763]  3.3e-19 SSF55048
SSF55048   Probable ACP-binding domain of malonyl-CoA ACP transacylase
IPR016038 Thiolase-like, subgroup (Domain)
 [34-295]  2.8e-90 G3DSA:3.40.47.10 [296-462]  1e-64 G3DSA:3.40.47.10
G3DSA:3.40.47.10   no description
IPR016039 Thiolase-like (Domain)
 [26-462]  1.4e-103 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1634-1635]  2e-33 G3DSA:3.40.50.720
G3DSA:3.40.50.720   no description
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [197-213]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [577-872]  1.4e-110 SM00827
SM00827   Acyl transferase domain in polyketide syntha
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1688-1760]  5.8e-30 SM00823
SM00823   Phosphopantetheine attachment site
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [937-1098]  1.3e-69 SM00826
SM00826   no description
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [36-462]  2e-220 SM00825
SM00825   Beta-ketoacyl synthase
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1404-1584]  1.4e-60 SM00822
SM00822   no description
SignalP No significant hit
TMHMM No significant hit