close all open/close all

CDS information : Lydi_00140


close this sectionLocation

Organism
StrainTP-A0598 (=NBRC 110027)
Entry nameLydicamycin
Contig
Start / Stop / Direction60,526 / 77,472 / + [in whole cluster]
60,526 / 77,472 / + [in contig]
Location60526..77472 [in whole cluster]
60526..77472 [in contig]
TypeCDS
Length16,947 bp (5,648 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)polyketide synthase
GeneTPA0598_03_00780
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[26380643] Draft genome sequence of marine-derived Streptomyces sp. TP-A0598, a producer of anti-MRSA antibiotic lydicamycins. (Stand Genomic Sci. , 2015)

close this sectionPKS/NRPS Module

11 malonyl-CoA
12 methylmalonyl-CoA
13 malonyl-CoA
KS35..409
AT572..884
DH930..1095
ER1418..1724
KR1734..1914
ACP2016..2086
KS2108..2485
AT2645..2960
DH3006..3169
KR3474..3654
ACP3755..3825
KS3847..4221
AT4376..4693
DH4739..4900
KR5208..5388
ACP5492..5562

close this sectionSequence

selected fasta
>polyketide synthase [polyketide synthase]
MAVQKDRVAEALRASLKETERLREQNRKLAGAMREPIAIVAMACRFPGANSPEELWRILD
SGTDAMSEFPADRGWDVASLYHPDPDHRGTSYVREGGFLDGVGEFDAGFFGISPREATAM
DPQQRLLLEASWETFERAGIDGLSLRGSRTGVFVGVNYQDYASQLRVAPEVAEGYGVTGA
SASVLSGRVAYTFGLEGPAITVDTACSSSLVALHWAMQALRAGECSLAVAGGVSVMSTPD
LFVEFSRQRGLAQDGRCKAFAGAADGTGWGEGAGLLLVERLSDAQRNGHPILAVVRGSAV
NQDGASNGLTAPNGPSQQRVIRQALASSRLSADQVDAVEAHGTGTTLGDPIEAQALLATY
GQDRPADRPLWLGSVKSNIGHTQAAAGAAGVIKMVMALRHGVLPKTLYVDEPTPHVDWSA
GAVRLLTEARDWPETGRPRRSGVSSFGISGTNAHVILEQAPEGEPAPEEAPVAPSAPSAA
AVLPWVLSARSRQALAAQARELMSFVADRPDLDPVDIGFSLATSRAALEHRAVVFGTGRD
ELLAHVEELAERGAEATGALCGVAGDGRVGVLFTGQGAQRLGMGRELYETYPVFAQAWDE
VCAELDPRLPRPLREVVWGEDQDLLHQTQYAQAALFTVEVALYRLMRSWGLTPDVLLGHS
IGEVTAAYLAGVWSTADAAQLVAARGRLMQALPAGGVMVSVRASEDEVVPLLEGREQVGI
AAVNGPESVVLSGAEDAVEQVIAALEADGRKVKRLRVSHAFHSPLMEPMLAEFRAVTEQL
TYQEPQFAVVSNVTGRLAEPGELCDPAYWVRHVREAVRFHDGIRAAHHEGVDLFVELGPG
GVLSAMGQDCLPETVAFRPSLRADRPEPEALRDTLAGAHVHGATVDWTPHLQGGRRTALP
TYAFQRRRYWLEGSADAGDVTAAGLGPAGHPLLGAAVALPDSDGFLFTGRLSLATHPWLA
DHAVSGTVLVPGTALVELAIRAGDQVGCDLLEELTLQTPLTLPGQGAVQTRVTVGEPAAD
GRREISVFSRPEDADGDEPWTQHATGFLATAAGTGTPAGFEESWPPAGAEPVAVDGFYEE
LSAAGFAYGPVFQGVRAAWRRGDEVFAEVALPAEAAEQAGRFGLHPALLDAAVQTVSLGT
SLTNGGPGLPFSWTGVRLHAVGAATLRARLSPSPDGGVAVLVADDTGAPVATIDSLAIRP
VSGTLKSAARDHWSSLFHLDWITLPEAGEPARPATWAAVGSGTDTVAGTLRAAGTEVVTA
EDFAALAARDTVPDAVLWALPEAAPGELPDRVRETTTRTLAALRGWLAEERFATSRLVIL
TRGAVSVTDERSPDLAPAPVWGLVRSAQTENPDRFLLIDLDDQEASCRALPAALASGEPQ
LALRGGTLHATRLMKAASAAPLTPPDGRAWQLTSTAKGNLDALSLVDSDRACGALAGHHV
RIEVRAAGLNFRDVLSALDMYPGDAGAMGLEGAGVIVEVGSGVTGLAPGDRVMGTFTEAF
GPLAVADHRAIVRIPEGWSFAEAAATPIVFLTAYYALVDLAGVQPGDTVLVNSAAGGVGM
AAVQLATHLGAEVYGTASPAKWDALRDLGLDDDHIASSRTLDFENQFLAATGGRGMDVVL
DSLAGEFVDASLRLLPSGGRFIEMGKADVRDADEIATAYPGVRYRAFDLPEAGPERTREM
FTDLLALFDRGVLRPLPLTTWDVRRAPDAFRYISQARQVGKVVLTIPPAPHPDGTVLITG
ASGTLAAVIARHLVAEHRVRHLLLVSRRGADAPGATDLRAELTALGAEVTLASCDIADRA
AVAALLAAVPTETPLTGVVHTAGVLSDGVIDSLTPERLDHVLRPKVDGAWHLHELTKDLD
LSAFVLFSSVSGMFGGPGQGNYAAANTFLDALAAHRRALGLPALSLPWGLWAEASAMTGK
LAEHDVRRAASGGVLPMTSEEGVALYDAAATVVRAVVTPAKLELKGVTAAELPPVLSGLV
RTPSRRAAAALTAPDAGNTLVQRLAALSTADQDRTLLDLVRTQVAAVLGYPGPEAVEAER
AFSELGFDSLTAVELRNRINSGTALRLPATLVFDYPNSLALVNHLRGELLGRQTDTPAPV
QSSAAADDEPIAIVGMACRYPGGVESPEDLWRLLADGTDALSGFPADRGWNLDELYHPDP
DHRGTSYARAGGFLADATGFDPAFFGISPREALAMDPQQRLLLETSWEAFESAGIDPQSV
RGTKTGVFAGATSDDYATQLAPVFDQTEGYASTGTAGSVVSGRISYSFGLEGPALTVDTA
CSSSLVALHLAIQALRSGECSLALAGGVTVLATPDVFIEFSRQRGLAADGRCKPFADAAD
GTGWGEGAGMLLVERLSDARRNGHPVLAVVRGSAVNQDGASNGLTAPNGPSQQRVIRQAL
ANAGLEASDVDAVEAHGTGTTLGDPIEAQALLATYGQDRPEDRPLWLGSIKSNIGHTQSA
AGAAGVIKMVMALRHGVLPKTLHVDEPSSHVDWSAGAVELLTEAREWPESGQLRRAGVSS
FGISGTNAHVVLEQAPPASEPEAVEPAEAAPAGVVPWVLSARSEQALVAQAGRLASFVAD
RPELDPADVGFSLLSTRAGLEYRAVVLGADGADLLEGLRGLAAGMDPAGVVRGSTGTGAG
TRVALVFPGQGSQWLGMADQLLANSPVFAGRMAECGAALSEFVSWDLMAVLSDEDALARV
DVVQPVLWAVMVSLAAVWEDCGVVPSAVVGHSQGEIAAACVAGILSLRDGARVVALRSQA
IGRVLAGRGGMVSVAGSREAVQERIARWGERVSVAAINGPASTVVSGEPEALQELLAECA
EQDVRARPIPVDYASHGPQVEELREELATVLAEVAPAEGRIPFYSAVNASLISGEELDAG
YWFENLRNPVRFEEAVQALLSDGHGVFVECSAHPVLTPGIEDTAQEAGSPVVVTGTLRRD
EGGWSRFAQSLGQLWAHGVPVDWSTLVPAGRRVDLPTYAFQHKRYWPSGVFFGGDASGLG
LDAADHPLLGAAMALPDSDGFLFSGRLSLATHPWLADHSVLDTVLLPGTGLVELAIRAGD
QVGCDLLEELTLEAPLIIPATGGRQLRVTVGESDADGRRELAVYSRAEEAPADQQWTRHA
TGTLALGAGPVDFGEESWPPRGAEPVSVTGVYDEFAAVGMTYGPVFQGLGAAWRRGEEIF
AEVALPEDMAADAAKFGLHPALLDSALHAIGLHPVNEAGGQAQLPFAWNTVRLHAVGAAA
LRVKLSPAGGGFSVLVADGTGTVVASVDSLVTRPVTVGQLNEGPGTDALFTVEWSELPLR
SEPVAGSWAVLGDDVGLAAALGASGADVLSELVDVPECVVLAVPRSDGALEVPAAVRATL
GRVLESVQSWLADERCTRSKLVIATRGAVSVAGEPLDAVGGAVWGLLRSAQTENPDQFVL
IDLDECESSVEAIAAAAASGEPQLAVRDGVVSVPRLARSVPSDADSAPVWDPEGTVLITG
GTGTLGALFARHLVSEHGVRSLVLTSRRGLEADGAEELQSELTELGAQVEVVACDAADRD
ALAAVLASIPADVPLTGVVHTAGVLDDGIIGSLTPERLDTVLRPKVDAAWNLHELTQGLD
LSAFVLFSSAAGVLGSAGQGNYAAANTFLDALAQHRRLSGLPGTSLAWGFWAERSAMTRE
VGSADVRRMARGGALALDQAEGVALFDLACAAPGSGLLVPIRLDLRGLAASGAVPAVLRN
VVRVPVRRATAAAGEAASLRERLAGLPAEDRAELLLDLVTTQVAAVLGYEDSGAVRTDQV
FKDLGFDSLTAVELRNRLTGATGLRLPATLVFDYPTPLALTDCLRRELLEEETAVVPTTR
AAGTDEEAIAIVGMACRYPGGVTSPEELWQLLAAGTDAIGEFPADRGWDLDRLYDPEPGL
PGKTYTREGGFLYDAGEFDPAFFGISPREALAMDPQQRLLLEMSWEAVERAGIAPASLHG
SRTGVFAGIMYHDYGLQTDSIPEEVEGHLGTGTSGSVASGRVAYTFGFEGAAVTVDTACS
SSLVALHQAMQALRAGECELALAGGASVMATPGTFVDFSRQRNLASDGRVKAFASGADGT
TLAEGAGMLLVERLSDARRNGHPVLAVVRGSAVNQDGASNGLTAPNGPSQQRVIRQALAN
AGLEASEVDAVEAHGTGTTLGDPIEAQALLATYGQDREEPLWLGTVKSNIGHTQAAAGVA
GVMKMVLAMRRGVLPRTLHVDEPSSHVDWSAGAVELLTEARDWPTTGRPRRAGVSSFGIS
GTNAHVVLEEAPGPVAEEPTATGADSDTGAGAGVVPWVLSARSGESLAAQAGRLASFVAA
QPDLSPTDIGFSLVTTRTPLDHRAVVLGTDRTELLAALRNVTPDADVIGDPRLGVLFTGQ
GAQRLGMGRELYDAYPVFARAWDEVCAELDGLLPRPLREAVWGEDDLLDQTQYAQAALFA
LEVALYRLVESHGVTPDVLLGHSIGEVTAAYLAGVWSLADAAKLVAARGRLMQALPAGGV
MASVRASEDEVTPLLEGREQVGIAAVNGPESLVISGAEAEVEQIAAALEAEGRKVKRLRV
SHAFHSPLMDPMLADFRTVLEQLTYNEAELALISNVTGRLADPAELRDPEYWVRHVREAV
RFHDGIQAAHAEGVTTFLELGPDGVLSAMGQDCLPQTATTTAPVTLQPTLRKDRPEPVAL
LHALGVAYARGVPVDWTPLFPGARAVELPTYAFQRRRYWLEGTAGAGDMTAAGLGNAEHP
LLGATVTLPDAVVLSGRLSLATHPWLADHAVMDTVLLPGTALVELALQAGDRLGCDLIEE
LTLQEPLVLPERGGVQLRVVVAEPEEDGRRPLTVYSRPEGDAEEDWTRHAVGVLAAGSAV
PAGEGAEVWPPAGAESVSVDGFYDELAAAGFGYGPMFQGVQAAWRHGDEVHAEVTLPEDA
AAEAAKFALHPALLDAALQTVGLLDDAAAGLPFAWRGIRLHAVGAGALRTTLTRDGDGVR
VKVCDETGALVATIDGLTVRPVRTEQLAGGRGESMLQLRWTSLPLPGTATVSAENWAVLD
ENGIGLKAVLDAPAFDWSALAEQDEVPDVALWSVPDIAGKGLAEGAHALARLVLERLQSW
LAEERYQDARLVILTRGAVLLDGDTVSPAAAAVWGLVRSAQSEHPDRIVLIDADADALGN
EGAGHALRAAVASGEPQLALRGGSVLVPRLARFAAPGQVGAPRWNAEGTVLITGGTGALG
ALVARHLAAEHGVRKLLLISRQGPAAEGAGELRAELAGLGASAEIVACDAADRDALARVL
ADLPAEAPLTGVVHTAGVLDDGVFGSLTPERLDAVLSPKVDAAVNLHELTKGRELSAFVL
FSSAAGVLGAPGQANYAAANSFLDALAGYRRSLDLPAVSLAWGRWADTSEMTGGLDQADL
RRMSSGGIDALTSAEGLALFDAGTVSAESLLIPVRLNTAALHARAAGGMLPPVMRDLVRT
RVRRSAAGGKAMAEDLSRRLAGLSDPERQQLLLTVVRTQVAAVLGYSGPEEVPGGRPFSE
LGFDSLTAVELRNTLTAVTGLRLPATLVFDYPTSEVLAEKLRADLLGERDEQSGLLSVFA
GLDRLELSLPEIATDEVARDRLAVRLQSLLSGLGGAQEDDGAGTVAATLDAASDDEVFDF
IEREFGSS
selected fasta
>polyketide synthase [polyketide synthase]
ATGGCCGTGCAGAAAGACCGCGTCGCTGAGGCTCTGCGAGCATCGCTCAAGGAGACCGAA
CGGTTGCGTGAACAGAACCGCAAGCTCGCGGGCGCGATGCGGGAGCCGATCGCGATCGTC
GCGATGGCGTGCCGGTTCCCCGGCGCGAACTCTCCCGAGGAGCTGTGGCGGATCCTGGAC
TCCGGTACCGACGCCATGTCCGAATTCCCGGCCGACCGCGGCTGGGATGTGGCGAGCCTG
TACCACCCGGATCCCGACCACCGCGGGACCTCCTACGTCCGGGAAGGCGGCTTCCTGGAC
GGCGTCGGCGAGTTCGATGCCGGGTTCTTCGGGATCTCGCCGCGTGAGGCGACCGCGATG
GACCCGCAGCAGCGGCTGCTGCTCGAAGCCTCCTGGGAGACCTTCGAGCGGGCCGGCATC
GACGGGCTCTCGCTGCGCGGCAGCCGGACCGGCGTCTTCGTCGGGGTGAACTACCAGGAC
TACGCCTCGCAGCTGCGGGTGGCGCCCGAGGTGGCCGAGGGCTACGGCGTCACCGGCGCC
TCGGCGAGCGTGCTGTCCGGCCGCGTTGCCTACACCTTCGGCCTCGAAGGTCCCGCGATC
ACCGTGGACACCGCCTGTTCCTCGTCGCTGGTGGCGCTGCACTGGGCGATGCAGGCCCTG
CGCGCGGGGGAGTGCTCGCTGGCCGTGGCCGGCGGTGTGTCGGTGATGTCCACCCCCGAT
CTGTTCGTGGAGTTCTCCCGGCAGCGTGGTCTCGCCCAGGACGGCCGGTGCAAGGCCTTC
GCCGGTGCCGCGGACGGCACCGGCTGGGGTGAGGGCGCCGGGCTGCTGCTGGTGGAGCGG
CTGTCGGACGCCCAGCGCAACGGCCATCCGATCCTCGCGGTGGTGCGGGGTTCGGCGGTG
AACCAGGACGGTGCATCCAACGGTCTGACCGCCCCCAACGGACCCTCGCAGCAGCGGGTG
ATCCGGCAGGCCCTCGCCAGCAGCCGGCTGTCGGCCGATCAGGTCGACGCGGTGGAGGCG
CACGGCACCGGGACGACCCTCGGCGACCCCATCGAGGCGCAGGCGCTGCTGGCGACGTAC
GGGCAGGACCGGCCCGCCGACCGGCCGCTCTGGCTCGGCTCCGTGAAGTCCAACATCGGA
CACACCCAGGCCGCCGCGGGAGCCGCCGGGGTCATCAAGATGGTGATGGCCCTGCGGCAC
GGTGTGCTGCCCAAGACCCTGTACGTCGACGAGCCCACCCCGCACGTCGACTGGTCGGCC
GGCGCGGTGCGGCTGCTGACCGAGGCCCGCGACTGGCCGGAGACCGGCCGCCCCCGCAGG
TCCGGGGTGTCGTCCTTCGGGATCAGCGGCACCAACGCCCATGTCATCCTCGAACAGGCC
CCGGAAGGCGAACCGGCCCCGGAGGAAGCCCCGGTGGCGCCGTCCGCTCCGTCGGCGGCC
GCGGTGCTGCCCTGGGTGCTGTCCGCCCGTTCCCGCCAGGCCCTTGCCGCCCAGGCCCGT
GAACTGATGTCCTTCGTGGCCGACCGGCCGGATCTGGACCCGGTCGACATCGGCTTCTCC
CTGGCGACCAGCCGTGCCGCGCTGGAGCACCGTGCGGTCGTCTTCGGTACCGGGCGTGAC
GAACTCCTCGCCCATGTCGAGGAGTTGGCTGAGCGCGGGGCGGAGGCCACCGGTGCGCTG
TGCGGGGTCGCGGGCGACGGCCGGGTCGGTGTGCTGTTCACCGGCCAGGGAGCGCAGCGG
CTCGGGATGGGCCGTGAGCTGTACGAGACCTACCCGGTCTTCGCGCAGGCCTGGGACGAG
GTGTGCGCGGAGCTCGACCCGCGGCTGCCCCGGCCCCTGCGGGAGGTCGTGTGGGGTGAG
GACCAGGACCTCCTGCACCAGACCCAGTACGCCCAGGCCGCCCTGTTCACCGTCGAGGTC
GCGCTCTACCGGCTCATGCGGTCCTGGGGCCTGACCCCGGACGTGCTGCTGGGCCACTCC
ATCGGTGAGGTCACGGCCGCGTACCTGGCGGGTGTGTGGTCGACGGCGGACGCGGCGCAG
CTGGTCGCGGCGCGTGGGCGGCTGATGCAGGCGCTGCCGGCCGGCGGGGTGATGGTGTCG
GTGCGGGCCTCCGAGGACGAGGTCGTGCCGCTGCTGGAAGGCCGCGAGCAGGTCGGGATC
GCCGCCGTCAACGGCCCCGAGTCCGTCGTGCTCTCGGGTGCCGAGGACGCGGTGGAGCAG
GTCATCGCCGCTCTGGAGGCCGACGGCCGTAAGGTCAAGCGGCTGCGGGTGAGCCATGCC
TTCCACTCGCCGCTCATGGAGCCGATGCTCGCCGAGTTCCGCGCGGTCACGGAGCAACTC
ACCTATCAGGAACCGCAGTTCGCGGTGGTGTCCAACGTGACCGGACGCCTGGCCGAGCCC
GGGGAACTGTGCGATCCGGCCTACTGGGTCCGCCACGTCCGTGAGGCCGTACGCTTCCAC
GACGGCATCCGGGCCGCACACCACGAAGGCGTGGACCTCTTCGTGGAACTCGGTCCCGGC
GGGGTGCTCTCCGCCATGGGCCAGGACTGTCTGCCGGAGACCGTCGCGTTCCGGCCGAGC
CTGCGCGCGGACCGCCCCGAACCCGAGGCCCTGCGCGACACCCTCGCCGGTGCCCACGTA
CACGGTGCCACCGTCGACTGGACCCCACACCTCCAGGGCGGCCGGCGCACCGCCCTGCCC
ACCTACGCCTTCCAGCGCCGGCGGTACTGGCTCGAAGGCTCCGCCGACGCCGGGGATGTG
ACGGCCGCCGGACTCGGCCCGGCCGGACACCCCCTCCTCGGCGCCGCCGTGGCGCTGCCC
GACTCCGACGGCTTCCTCTTCACCGGCCGGCTGTCCCTGGCCACCCACCCCTGGCTCGCC
GACCACGCGGTCTCCGGCACCGTGCTGGTACCGGGCACCGCACTGGTCGAACTCGCCATC
CGCGCCGGGGACCAGGTCGGCTGCGACCTGCTGGAGGAACTCACCCTCCAGACGCCCCTG
ACCCTCCCCGGCCAGGGCGCGGTGCAGACCCGCGTCACCGTCGGCGAGCCGGCCGCGGAC
GGCCGCCGGGAGATCTCGGTGTTCTCCCGCCCCGAAGACGCCGACGGCGATGAGCCCTGG
ACGCAGCACGCCACCGGCTTCCTCGCCACGGCGGCCGGCACCGGCACACCCGCCGGATTC
GAGGAGTCCTGGCCACCCGCCGGGGCCGAGCCCGTCGCCGTCGACGGCTTCTACGAGGAG
CTGTCCGCCGCCGGATTCGCGTACGGACCGGTCTTCCAGGGCGTGCGGGCCGCGTGGCGG
CGCGGCGACGAGGTGTTCGCCGAGGTCGCGCTGCCCGCGGAAGCGGCCGAACAGGCGGGG
CGGTTCGGTCTGCATCCGGCTCTGCTCGACGCGGCCGTACAGACCGTGAGCCTCGGTACG
TCCCTCACCAACGGCGGGCCCGGCCTGCCGTTCTCCTGGACCGGCGTCCGGCTGCACGCC
GTCGGCGCGGCCACCCTGCGCGCCAGACTCTCCCCGTCCCCGGACGGCGGGGTCGCGGTC
CTCGTCGCCGACGACACCGGCGCACCCGTGGCCACCATCGACTCCCTGGCGATCCGGCCC
GTCTCCGGCACCCTCAAGTCCGCCGCCCGCGACCACTGGTCCTCGCTCTTCCACCTCGAC
TGGATCACGCTGCCCGAAGCGGGCGAGCCCGCCCGCCCGGCCACCTGGGCGGCCGTCGGC
AGCGGCACCGACACCGTGGCCGGAACGCTGCGCGCCGCCGGCACCGAGGTGGTGACGGCC
GAGGACTTCGCGGCCCTCGCCGCGCGGGACACCGTGCCGGACGCCGTGCTCTGGGCCCTG
CCGGAGGCCGCGCCCGGCGAACTGCCGGACCGGGTACGGGAGACCACCACCCGGACGCTG
GCCGCCCTGCGCGGCTGGCTGGCCGAGGAGCGGTTCGCCACGTCCCGGCTGGTCATCCTC
ACCCGGGGCGCGGTCTCCGTCACCGACGAGCGCAGCCCGGACCTCGCCCCCGCCCCGGTA
TGGGGACTGGTCCGGTCCGCGCAGACCGAGAACCCGGACCGCTTCCTGCTCATCGACCTC
GACGACCAGGAAGCCTCCTGCCGCGCGCTGCCCGCCGCCCTCGCCTCCGGGGAACCGCAG
CTCGCGCTGCGCGGCGGCACCCTGCACGCCACCCGTCTGATGAAGGCCGCCTCCGCCGCC
CCGCTGACCCCGCCGGACGGCCGGGCCTGGCAGCTCACCAGCACCGCCAAGGGCAACCTG
GACGCCCTCTCGCTGGTGGACAGCGATCGGGCCTGCGGAGCACTGGCCGGGCACCACGTC
CGGATCGAGGTACGCGCCGCCGGCCTCAACTTCCGGGACGTCCTCAGTGCCCTGGACATG
TACCCCGGTGACGCCGGAGCGATGGGCCTGGAAGGCGCAGGCGTCATCGTCGAGGTCGGC
TCCGGCGTGACCGGCCTCGCCCCCGGCGACCGGGTGATGGGTACCTTCACCGAAGCCTTC
GGCCCCCTCGCCGTCGCCGACCACCGGGCCATCGTCCGCATCCCCGAGGGCTGGTCCTTC
GCCGAGGCAGCGGCCACCCCGATCGTCTTCCTCACCGCCTACTACGCCCTGGTCGATCTG
GCCGGAGTGCAGCCGGGCGACACCGTGCTGGTGAACTCCGCCGCCGGCGGCGTGGGCATG
GCCGCGGTCCAGCTGGCCACCCACCTCGGCGCCGAGGTCTACGGCACCGCCAGTCCCGCG
AAGTGGGACGCCCTGCGGGACCTCGGCCTGGACGACGACCACATCGCCTCCTCCCGGACC
CTGGACTTCGAGAACCAGTTCCTGGCCGCCACCGGGGGCCGGGGCATGGACGTCGTACTC
GACTCCCTGGCCGGCGAGTTCGTGGACGCCTCCCTGCGGCTGCTGCCCTCGGGCGGCCGG
TTCATCGAGATGGGCAAGGCCGATGTCCGCGACGCGGACGAGATCGCCACCGCCTACCCC
GGCGTCCGCTACCGCGCCTTCGACCTCCCCGAGGCCGGGCCGGAACGCACCCGCGAGATG
TTCACCGACCTGCTCGCCCTGTTCGACCGCGGCGTGCTGCGCCCGCTGCCGCTCACCACC
TGGGATGTGCGCCGCGCCCCGGACGCCTTCCGGTACATCAGCCAGGCCCGCCAGGTCGGC
AAGGTCGTACTCACCATCCCGCCGGCGCCGCACCCGGACGGCACGGTACTGATCACCGGG
GCCAGCGGCACCCTCGCCGCCGTCATCGCCCGGCACCTGGTGGCCGAGCACCGGGTGCGC
CACCTCCTGCTGGTCAGCCGGCGCGGCGCCGACGCGCCCGGCGCGACCGACCTGCGTGCC
GAACTCACCGCACTCGGCGCCGAGGTCACCCTGGCCTCCTGCGACATCGCCGACCGGGCC
GCGGTGGCCGCGCTGCTCGCCGCTGTCCCCACGGAGACCCCGCTGACCGGTGTCGTGCAC
ACCGCCGGGGTGCTCTCCGACGGAGTGATCGACTCGCTCACCCCCGAGCGGCTCGACCAT
GTCCTGCGGCCGAAGGTGGACGGCGCCTGGCACCTCCACGAACTCACCAAGGACCTCGAC
CTCTCCGCCTTCGTCCTGTTCTCCTCGGTGTCCGGGATGTTCGGCGGTCCGGGGCAGGGC
AACTACGCCGCCGCGAACACCTTCCTGGACGCCCTGGCCGCACACCGCCGCGCGCTCGGC
CTGCCCGCGCTCTCCCTGCCGTGGGGACTGTGGGCCGAGGCCAGCGCCATGACCGGGAAG
CTGGCCGAGCACGATGTGCGGCGCGCCGCCTCCGGTGGCGTCCTGCCGATGACCTCGGAA
GAGGGCGTCGCGCTGTACGACGCGGCCGCCACCGTCGTCCGGGCGGTGGTCACGCCCGCC
AAGCTGGAACTGAAGGGTGTCACCGCGGCGGAACTGCCGCCCGTGCTCAGCGGCCTGGTA
CGCACCCCGTCCCGGCGCGCCGCTGCCGCGCTCACCGCACCGGACGCCGGCAACACCCTC
GTCCAGCGGCTCGCCGCACTCTCCACCGCCGACCAGGACCGGACCCTGCTCGACCTGGTA
CGTACGCAGGTGGCCGCGGTGCTCGGCTATCCGGGTCCCGAGGCGGTGGAGGCCGAGCGC
GCCTTCTCCGAGCTCGGCTTCGACTCGCTGACCGCGGTGGAACTCCGCAACCGGATCAAC
AGCGGCACCGCACTGCGGCTGCCCGCGACCCTCGTCTTCGACTACCCGAACTCGCTCGCC
CTGGTGAACCACCTGCGCGGCGAACTGCTCGGCCGGCAGACCGACACCCCGGCGCCCGTA
CAGTCCTCCGCTGCCGCCGACGACGAGCCGATCGCCATCGTCGGCATGGCCTGCCGGTAC
CCCGGCGGAGTGGAGTCGCCCGAGGACCTCTGGCGACTGCTCGCCGACGGCACCGATGCG
CTGTCCGGCTTCCCCGCGGACCGGGGCTGGAACCTCGACGAGCTGTACCACCCGGACCCC
GACCACCGCGGCACCTCCTATGCGCGCGCGGGCGGCTTCCTCGCCGACGCCACCGGCTTC
GACCCCGCCTTCTTCGGGATCTCGCCGCGCGAGGCCCTGGCCATGGACCCCCAGCAGCGA
CTGCTGCTGGAGACCTCCTGGGAGGCCTTCGAGAGCGCCGGAATCGACCCCCAGTCGGTC
CGCGGCACCAAGACCGGTGTGTTCGCCGGCGCGACCTCGGATGACTACGCGACCCAACTG
GCCCCGGTGTTCGACCAGACCGAGGGGTACGCCAGCACCGGCACCGCGGGCAGCGTCGTC
TCCGGCCGCATCTCGTACTCCTTCGGTCTCGAAGGCCCGGCACTGACCGTGGACACGGCC
TGCTCGTCCTCCCTGGTGGCCCTGCATCTGGCCATCCAGGCGCTGCGCTCCGGCGAGTGC
TCACTGGCACTGGCCGGCGGGGTCACGGTGCTGGCCACCCCGGACGTGTTCATCGAGTTC
TCCCGCCAGCGCGGCCTCGCCGCGGACGGCCGCTGCAAGCCCTTCGCGGACGCGGCGGAC
GGCACGGGATGGGGCGAAGGCGCCGGCATGCTGCTCGTCGAGCGGCTGTCGGATGCCCGG
CGCAACGGTCACCCGGTGCTTGCGGTGGTGCGGGGTTCGGCGGTGAACCAGGACGGTGCG
TCCAACGGTCTGACGGCGCCGAACGGTCCCTCGCAGCAGCGGGTGATCCGCCAGGCGCTC
GCCAACGCCGGACTCGAAGCGTCGGATGTGGACGCGGTGGAGGCACACGGCACGGGAACG
ACGCTCGGCGACCCGATCGAGGCCCAGGCGCTGCTGGCCACATACGGCCAGGACCGCCCC
GAGGACCGGCCCCTGTGGCTGGGCTCGATCAAGTCCAACATCGGGCACACCCAGTCGGCG
GCCGGCGCGGCCGGCGTCATCAAAATGGTCATGGCGCTGCGGCACGGTGTGCTGCCCAAG
ACGCTGCATGTGGACGAGCCGTCGTCGCATGTCGACTGGTCCGCGGGTGCGGTGGAGCTG
CTGACGGAGGCCAGGGAGTGGCCCGAGAGCGGTCAGCTGCGTCGGGCGGGTGTGTCGTCC
TTCGGTATCAGCGGGACGAACGCGCATGTGGTGCTGGAGCAGGCACCTCCCGCCTCTGAG
CCGGAGGCCGTGGAACCGGCTGAGGCTGCGCCTGCCGGGGTGGTGCCGTGGGTGCTGTCG
GCGCGCTCGGAGCAGGCGCTGGTTGCCCAGGCGGGCCGGTTGGCGTCCTTCGTGGCGGAC
CGTCCGGAGCTGGATCCTGCTGATGTGGGGTTCTCGCTCCTGAGTACCCGGGCGGGGTTG
GAGTACCGGGCGGTGGTGCTCGGTGCTGACGGTGCGGACCTTCTTGAGGGCCTTCGTGGG
CTGGCTGCGGGGATGGACCCTGCGGGTGTGGTGCGGGGTTCGACCGGTACGGGAGCCGGT
ACCCGTGTGGCGCTGGTGTTCCCTGGTCAGGGCTCGCAGTGGCTGGGTATGGCGGACCAA
CTGCTGGCCAATTCGCCGGTGTTCGCGGGGCGGATGGCTGAGTGTGGTGCGGCGCTGTCG
GAGTTTGTGTCCTGGGATCTGATGGCGGTGCTGTCGGATGAGGACGCGTTGGCGCGGGTT
GATGTGGTGCAGCCGGTGCTGTGGGCGGTGATGGTGTCGTTGGCTGCGGTCTGGGAGGAC
TGCGGCGTGGTGCCGTCGGCCGTGGTGGGGCACTCCCAGGGCGAGATCGCCGCGGCCTGC
GTGGCCGGGATTTTGTCGTTGCGTGATGGTGCCCGGGTGGTGGCGTTGCGCAGTCAGGCC
ATCGGTCGGGTGCTGGCTGGTCGCGGCGGCATGGTGTCGGTTGCCGGCTCCCGCGAGGCA
GTCCAGGAGCGCATTGCCAGGTGGGGCGAGCGGGTGTCCGTAGCCGCCATCAACGGCCCG
GCGTCGACCGTGGTTTCCGGTGAACCCGAAGCGTTGCAGGAGTTGCTGGCGGAGTGCGCT
GAGCAGGACGTACGGGCCCGGCCGATCCCGGTGGACTACGCCTCCCATGGCCCCCAGGTT
GAGGAGCTGCGCGAGGAGCTCGCGACGGTTCTGGCTGAGGTGGCGCCTGCGGAAGGCCGG
ATCCCGTTCTACTCGGCGGTGAACGCTTCGCTCATATCGGGCGAGGAGCTTGATGCCGGG
TACTGGTTCGAGAACCTGCGCAATCCGGTGCGGTTCGAGGAAGCCGTCCAGGCGCTGCTG
TCCGACGGCCATGGCGTCTTCGTCGAATGCAGCGCGCACCCCGTCCTGACGCCTGGCATC
GAGGACACGGCACAGGAAGCAGGCAGCCCCGTCGTGGTGACGGGCACCCTGCGCCGCGAC
GAAGGCGGTTGGTCCCGGTTCGCGCAATCGCTGGGCCAGCTCTGGGCGCACGGCGTCCCG
GTGGACTGGAGCACCCTGGTTCCGGCCGGTCGGCGGGTCGACCTGCCCACTTATGCCTTC
CAGCACAAGCGCTACTGGCCCTCCGGTGTGTTCTTCGGCGGGGACGCCTCGGGGCTCGGA
CTCGATGCGGCCGATCATCCGCTGCTCGGCGCCGCGATGGCGCTGCCGGACTCCGACGGC
TTCCTCTTCAGTGGCCGGCTGTCGCTCGCCACGCACCCCTGGCTGGCCGATCACTCCGTA
CTGGACACCGTGCTGCTCCCCGGGACCGGACTGGTGGAGCTGGCCATCCGGGCTGGTGAC
CAGGTCGGTTGCGATCTGCTGGAGGAGCTCACCCTTGAGGCCCCGCTGATCATCCCGGCG
ACCGGAGGTCGGCAACTCCGTGTCACCGTCGGTGAGTCCGATGCGGACGGTCGCCGTGAA
CTCGCCGTGTACTCCCGTGCCGAGGAGGCTCCGGCAGACCAGCAGTGGACCCGGCACGCC
ACCGGCACGCTCGCGCTGGGTGCCGGTCCGGTGGACTTCGGTGAGGAGAGCTGGCCTCCC
CGCGGCGCTGAGCCGGTCTCTGTGACCGGCGTGTACGACGAGTTCGCCGCGGTGGGTATG
ACTTACGGCCCGGTGTTCCAGGGCCTGGGCGCAGCCTGGCGGCGTGGTGAGGAGATCTTC
GCCGAGGTCGCTCTGCCCGAGGACATGGCTGCCGACGCGGCGAAGTTCGGGCTGCATCCG
GCCCTGCTCGACTCCGCGCTGCATGCGATCGGTCTCCACCCGGTCAACGAGGCCGGGGGA
CAAGCCCAGCTGCCTTTCGCCTGGAACACGGTCCGTCTGCACGCCGTGGGAGCGGCCGCA
CTACGGGTGAAGCTGAGCCCGGCCGGCGGCGGTTTCTCGGTCCTGGTCGCCGATGGCACG
GGAACCGTGGTCGCCTCCGTCGACTCCCTGGTGACCAGGCCGGTGACCGTCGGCCAGCTC
AACGAAGGCCCGGGCACGGATGCCCTGTTCACCGTGGAGTGGTCGGAGTTGCCGCTTCGG
TCTGAGCCGGTGGCGGGTTCGTGGGCCGTCCTTGGTGACGATGTGGGGCTGGCTGCGGCG
TTGGGTGCGTCGGGTGCGGACGTGCTGAGTGAGCTGGTGGACGTGCCGGAGTGTGTGGTG
CTGGCGGTGCCTCGTTCGGATGGTGCGTTGGAGGTGCCGGCGGCGGTTCGGGCCACGCTG
GGCCGGGTGCTGGAGAGCGTGCAGTCGTGGCTGGCTGATGAGCGTTGCACGCGTTCGAAG
CTGGTGATCGCGACCCGCGGCGCCGTGTCGGTGGCGGGAGAACCGCTGGATGCCGTGGGC
GGCGCGGTGTGGGGCCTGCTGCGTTCGGCGCAGACCGAGAACCCGGATCAGTTCGTGCTC
ATCGACCTTGACGAGTGTGAGTCGTCGGTGGAGGCCATCGCTGCGGCGGCTGCTTCGGGT
GAGCCGCAGTTGGCGGTTCGCGACGGGGTGGTATCCGTCCCGCGTTTGGCGAGGTCCGTA
CCGTCGGATGCGGATAGTGCGCCGGTATGGGACCCCGAGGGCACGGTGCTGATCACGGGT
GGCACGGGCACGTTGGGTGCACTCTTCGCCCGGCATCTGGTGTCTGAACATGGTGTCCGC
AGCCTGGTGTTGACCAGTCGCCGTGGTTTGGAGGCCGACGGGGCTGAGGAGTTGCAGTCC
GAGCTGACGGAGCTGGGCGCTCAGGTCGAGGTCGTGGCATGTGACGCGGCTGACCGTGAC
GCGCTGGCCGCCGTGCTGGCAAGCATTCCTGCCGACGTCCCGCTGACGGGTGTGGTGCAC
ACGGCCGGTGTTCTGGACGACGGCATCATCGGCTCGCTGACCCCGGAACGCCTGGACACT
GTGCTTCGGCCGAAGGTGGACGCGGCCTGGAACCTCCATGAGTTGACCCAGGGCCTGGAC
CTGTCGGCATTCGTGCTGTTCTCCTCGGCTGCCGGTGTGCTCGGCAGCGCCGGGCAGGGC
AACTACGCGGCGGCGAATACGTTCCTCGACGCCCTTGCACAGCACCGTCGCCTCAGTGGA
CTGCCGGGTACCTCCCTGGCCTGGGGATTCTGGGCGGAGCGCAGTGCGATGACCCGGGAG
GTCGGCTCCGCCGATGTCCGGCGGATGGCCCGCGGTGGTGCGCTTGCGCTCGACCAGGCC
GAGGGTGTGGCCCTGTTCGACCTCGCCTGTGCCGCGCCCGGCTCCGGCCTGCTCGTGCCG
ATCCGGCTCGATCTGCGTGGTCTGGCCGCTTCCGGCGCGGTGCCGGCGGTGCTGCGGAAC
GTCGTACGGGTGCCGGTGCGGCGCGCCACCGCAGCGGCCGGTGAGGCCGCGTCCCTGCGG
GAGCGGCTGGCCGGACTGCCGGCCGAGGACCGTGCGGAGCTGCTGCTCGACCTGGTGACC
ACTCAGGTCGCGGCCGTACTGGGCTACGAGGACTCCGGCGCGGTCCGTACGGACCAGGTG
TTCAAGGATCTCGGGTTTGATTCGCTGACCGCCGTGGAGCTGCGCAACCGACTGACCGGG
GCCACTGGGCTGCGGCTGCCCGCCACCTTGGTGTTCGACTATCCGACACCCCTCGCGCTC
ACCGACTGTCTGCGTCGCGAACTGCTGGAGGAGGAGACGGCGGTCGTACCCACCACGCGG
GCCGCCGGCACGGACGAAGAGGCCATCGCGATCGTCGGTATGGCCTGCCGGTACCCCGGT
GGTGTCACCTCGCCCGAGGAGCTCTGGCAGCTGCTGGCGGCCGGGACCGACGCCATCGGA
GAGTTCCCCGCCGACCGTGGCTGGGACCTCGACCGGCTCTATGACCCCGAACCCGGTCTG
CCCGGCAAGACCTACACCCGTGAGGGCGGATTCCTTTACGACGCGGGCGAGTTCGACCCG
GCATTCTTCGGCATCTCCCCGCGCGAGGCACTGGCCATGGACCCGCAGCAGCGGCTCCTG
TTGGAGATGTCCTGGGAGGCCGTCGAACGGGCCGGGATCGCCCCGGCCTCCCTGCACGGC
AGCAGGACCGGTGTCTTCGCCGGCATCATGTACCACGACTACGGCTTGCAGACCGACTCC
ATACCGGAGGAGGTCGAAGGCCACCTCGGTACGGGGACCTCCGGCAGTGTCGCCTCCGGC
CGGGTGGCATACACCTTCGGCTTTGAAGGGGCCGCGGTCACTGTGGACACGGCCTGCTCC
TCTTCGCTGGTGGCGCTGCATCAGGCGATGCAGGCGCTGCGGGCGGGGGAGTGTGAACTC
GCGCTGGCGGGCGGCGCCTCGGTGATGGCGACCCCGGGCACCTTCGTCGACTTCTCGCGG
CAGCGGAACCTGGCGAGCGACGGCCGGGTCAAGGCCTTCGCCTCGGGCGCGGACGGCACC
ACCCTCGCCGAGGGCGCCGGAATGCTCCTGGTGGAGCGGCTGTCGGATGCCCGGCGTAAC
GGCCATCCGGTGCTTGCGGTGGTGCGGGGTTCGGCGGTGAATCAGGACGGTGCGTCCAAC
GGTCTGACCGCGCCGAACGGCCCCTCGCAGCAGCGGGTGATACGTCAGGCGCTCGCCAAC
GCCGGACTCGAAGCGTCCGAGGTGGACGCGGTGGAGGCGCACGGCACCGGTACGACGCTC
GGCGACCCGATCGAGGCCCAGGCGCTGCTGGCGACCTACGGGCAGGACCGGGAAGAGCCG
TTGTGGCTGGGCACGGTCAAGTCGAACATCGGGCACACCCAGGCCGCGGCCGGCGTCGCC
GGCGTGATGAAGATGGTCCTTGCCATGCGGCGCGGCGTACTTCCGCGGACCCTGCATGTC
GATGAACCCTCCTCGCACGTCGACTGGTCGGCCGGTGCGGTCGAACTGCTCACCGAGGCG
CGCGACTGGCCGACCACCGGGCGGCCGCGCCGGGCGGGCGTGTCCTCCTTCGGGATCAGC
GGCACCAACGCGCACGTCGTGCTGGAAGAGGCGCCAGGACCGGTGGCCGAGGAGCCCACA
GCGACCGGTGCCGACTCGGACACCGGCGCCGGCGCCGGGGTCGTGCCCTGGGTGCTCTCG
GCCCGCTCTGGGGAGTCCCTCGCCGCACAGGCCGGACGGCTGGCGTCCTTCGTGGCAGCG
CAACCGGACCTGAGCCCGACCGACATCGGTTTCTCGCTGGTCACCACCCGTACCCCGCTG
GACCACCGCGCGGTGGTCCTGGGCACCGACCGTACGGAACTCCTCGCCGCCCTCCGGAAC
GTCACCCCGGACGCGGACGTCATCGGCGACCCACGACTCGGTGTGCTGTTCACCGGTCAG
GGCGCGCAGCGACTCGGCATGGGCCGTGAGCTGTACGACGCCTACCCGGTGTTTGCGCGG
GCCTGGGATGAGGTGTGTGCGGAGCTGGACGGTCTGCTGCCGCGGCCCTTGCGTGAGGCG
GTCTGGGGCGAGGATGACCTGCTCGATCAGACGCAGTACGCCCAGGCGGCGCTGTTCGCC
CTCGAAGTCGCCCTCTACCGCCTCGTCGAATCCCACGGTGTGACGCCGGATGTGCTGCTG
GGGCACTCCATCGGTGAGGTCACGGCTGCCTACCTTGCCGGTGTGTGGTCGCTGGCGGAC
GCGGCGAAGCTGGTCGCGGCACGTGGGCGCCTGATGCAGGCCCTGCCCGCCGGCGGCGTC
ATGGCGTCGGTGCGGGCCTCGGAGGACGAGGTCACGCCGCTGCTGGAGGGCCGCGAGCAG
GTCGGCATCGCTGCCGTCAACGGCCCAGAGTCCCTCGTGATCTCCGGCGCCGAGGCCGAG
GTGGAGCAGATCGCCGCCGCCCTGGAGGCCGAGGGCCGCAAGGTCAAGCGGCTGCGGGTG
AGCCATGCCTTCCACTCGCCGCTGATGGACCCGATGCTGGCCGACTTCCGCACGGTTCTG
GAACAACTCACCTACAACGAAGCCGAGTTGGCGCTGATTTCGAACGTGACCGGCCGTCTC
GCCGACCCCGCCGAGCTTCGTGACCCGGAGTACTGGGTGCGGCACGTCCGGGAAGCCGTC
CGCTTCCACGACGGCATCCAGGCCGCCCACGCCGAGGGTGTCACCACCTTCCTCGAACTC
GGTCCGGACGGCGTCTTGTCCGCCATGGGCCAGGACTGCCTACCGCAGACCGCCACTACT
ACCGCCCCCGTCACCCTCCAGCCGACCCTGCGCAAGGACCGCCCCGAACCCGTCGCCCTG
CTGCATGCTCTCGGCGTTGCCTACGCCCGGGGCGTCCCGGTGGACTGGACGCCGCTGTTC
CCGGGCGCCCGCGCCGTGGAGCTGCCGACCTACGCGTTCCAGCGTCGGCGCTACTGGTTG
GAGGGGACCGCTGGAGCCGGCGATATGACGGCCGCAGGGCTGGGGAATGCCGAGCACCCG
CTGCTCGGTGCCACCGTGACGCTGCCGGACGCCGTCGTCCTGAGCGGGCGGCTGTCCCTG
GCCACCCATCCGTGGCTGGCCGACCACGCCGTCATGGACACCGTGCTGCTGCCGGGAACC
GCCCTGGTCGAACTGGCCCTCCAGGCCGGCGACCGGCTCGGTTGTGACCTCATCGAGGAA
CTGACCCTTCAGGAGCCGCTGGTTCTGCCGGAGCGGGGTGGCGTGCAGCTGCGCGTGGTC
GTCGCGGAGCCCGAGGAGGACGGCCGCCGGCCACTGACCGTGTACTCCCGCCCGGAGGGG
GACGCGGAGGAGGACTGGACCCGGCACGCCGTCGGTGTGCTGGCCGCCGGGAGCGCCGTG
CCGGCCGGCGAGGGCGCGGAGGTCTGGCCGCCGGCCGGGGCCGAGTCCGTCTCCGTGGAC
GGCTTCTACGACGAACTGGCCGCCGCCGGCTTCGGCTACGGCCCCATGTTCCAGGGGGTC
CAGGCCGCCTGGCGGCACGGGGACGAGGTCCATGCCGAGGTCACGCTGCCCGAGGACGCC
GCTGCCGAGGCGGCGAAGTTCGCACTGCATCCGGCCCTGCTCGATGCCGCGCTCCAGACC
GTCGGCCTGCTCGACGACGCCGCAGCGGGACTGCCGTTCGCCTGGCGCGGGATCCGGCTG
CACGCGGTGGGCGCCGGCGCGCTGCGTACCACGCTGACCCGGGACGGCGACGGGGTGCGG
GTGAAGGTCTGCGACGAGACCGGTGCGCTCGTGGCCACCATCGACGGGCTGACCGTCCGG
CCGGTGCGTACCGAGCAACTGGCCGGTGGCCGCGGGGAGTCGATGCTCCAGCTGCGCTGG
ACTTCGCTGCCCCTACCGGGCACCGCAACGGTGTCGGCCGAGAACTGGGCCGTGCTGGAC
GAGAACGGGATCGGTCTGAAGGCCGTCCTCGACGCGCCCGCGTTCGACTGGTCCGCGCTC
GCCGAGCAGGACGAGGTGCCGGACGTGGCGCTGTGGTCCGTGCCGGACATCGCGGGGAAG
GGCCTGGCCGAGGGTGCACATGCCCTCGCGCGCCTGGTGCTGGAGCGGCTCCAGAGCTGG
CTCGCCGAGGAGCGGTATCAGGATGCGCGGTTGGTGATCCTGACCCGTGGTGCGGTCCTG
CTGGACGGCGACACGGTCTCCCCGGCGGCAGCGGCGGTCTGGGGGCTCGTCCGGTCCGCG
CAGTCGGAGCACCCGGACCGAATCGTGCTGATCGACGCCGATGCCGACGCCCTTGGTAAC
GAGGGCGCCGGACATGCCCTGCGCGCCGCCGTGGCGTCCGGTGAACCGCAGCTGGCCCTG
CGCGGCGGGAGTGTTCTCGTGCCCAGGCTGGCCCGGTTCGCCGCGCCCGGACAGGTGGGT
GCGCCGAGGTGGAATGCCGAGGGCACCGTGCTGATCACGGGGGGAACCGGAGCCCTCGGT
GCCTTGGTGGCGCGGCATCTGGCCGCCGAACACGGGGTGCGCAAGCTGCTGTTGATCAGC
CGTCAGGGCCCGGCTGCCGAGGGCGCCGGGGAGCTTCGGGCGGAACTCGCCGGGCTCGGT
GCGAGCGCGGAGATCGTTGCCTGCGACGCGGCCGACCGGGACGCCCTGGCCCGGGTCCTC
GCCGACCTGCCCGCCGAAGCGCCGCTCACCGGAGTGGTGCACACGGCAGGTGTCCTGGAC
GACGGGGTGTTCGGTTCGCTCACCCCGGAGCGTCTCGACGCGGTGCTGTCGCCGAAGGTG
GACGCCGCGGTGAACCTGCATGAACTCACCAAGGGCCGCGAGCTCTCCGCGTTCGTGCTG
TTCTCCTCCGCGGCCGGGGTGCTCGGCGCCCCGGGGCAGGCGAACTATGCGGCGGCCAAC
AGCTTCCTGGACGCCCTGGCCGGCTATCGCCGTTCGCTGGACCTCCCGGCGGTCTCCCTC
GCATGGGGACGCTGGGCCGACACCAGTGAGATGACCGGTGGGCTCGACCAGGCCGACCTG
CGGCGGATGAGCAGTGGCGGCATCGACGCGCTGACCTCCGCGGAGGGGCTCGCCCTGTTC
GACGCCGGGACCGTCTCGGCGGAGAGCCTGCTGATTCCGGTACGGCTGAACACCGCCGCG
CTGCACGCCCGTGCGGCCGGAGGGATGCTGCCACCGGTCATGCGGGACCTGGTCCGGACG
CGCGTGCGCCGCTCCGCCGCCGGCGGGAAGGCCATGGCCGAGGACCTGAGCCGGCGCCTC
GCCGGACTCAGCGACCCCGAGCGGCAGCAACTGCTGCTCACCGTGGTGCGTACGCAGGTG
GCCGCGGTGCTGGGCTACTCCGGGCCGGAAGAGGTCCCCGGCGGGCGGCCGTTCAGCGAG
CTCGGGTTTGACTCACTGACCGCTGTGGAGCTGCGCAACACCCTGACCGCGGTCACCGGA
CTGCGGCTGCCGGCCACCCTGGTCTTCGACTATCCGACCTCGGAAGTCCTCGCCGAGAAG
CTCCGCGCGGATCTGCTCGGCGAACGGGACGAACAGTCCGGCCTCCTCTCCGTCTTCGCC
GGGCTCGACCGGCTGGAACTCTCGCTGCCCGAGATCGCCACGGACGAGGTCGCCCGGGAC
CGGCTCGCCGTCCGGCTCCAGAGCCTGCTGTCGGGGCTGGGCGGGGCGCAGGAGGACGAC
GGGGCGGGGACGGTCGCCGCGACGCTGGACGCGGCGAGCGACGACGAGGTCTTCGACTTC
ATTGAGCGAGAGTTCGGGAGTTCCTGA
[11] KS35..409
[11] AT572..884
[11] malonyl-CoA759..763
[11] DH930..1095
[11] ER1418..1724
[11] KR1734..1914
[11] ACP2016..2086
[12] KS2108..2485
[12] AT2645..2960
[12] methylmalonyl-CoA2833..2837
[12] DH3006..3169
[12] KR3474..3654
[12] ACP3755..3825
[13] KS3847..4221
[13] AT4376..4693
[13] malonyl-CoA4562..4566
[13] DH4739..4900
[13] KR5208..5388
[13] ACP5492..5562
[11] KS103..1227
[11] AT1714..2652
[11] malonyl-CoA2275..2289
[11] DH2788..3285
[11] ER4252..5172
[11] KR5200..5742
[11] ACP6046..6258
[12] KS6322..7455
[12] AT7933..8880
[12] methylmalonyl-CoA8497..8511
[12] DH9016..9507
[12] KR10420..10962
[12] ACP11263..11475
[13] KS11539..12663
[13] AT13126..14079
[13] malonyl-CoA13684..13698
[13] DH14215..14700
[13] KR15622..16164
[13] ACP16474..16686

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [759-872]  2.9e-79 G3DSA:3.40.366.10 [2832-2949]  7.9e-69 G3DSA:3.40.366.10 [4562-4683]  4.1e-77 G3DSA:3.40.366.10
G3DSA:3.40.366.10   no description
IPR006162 Phosphopantetheine attachment site (PTM)
 [2044-2059]  PS00012 [3783-3798]  PS00012 [5520-5535]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [2016-2086]  19.272 PS50075 [3755-3825]  20.23 PS50075 [5492-5562]  19.5 PS50075
PS50075   ACP_DOMAIN
 [2019-2085]  2.5e-09 PF00550 [3759-3823]  3.9e-10 PF00550 [5496-5558]  9.3e-08 PF00550
PF00550   PP-binding
 [2009-2125]  5e-26 SSF47336 [3748-3863]  9.3e-27 SSF47336 [5483-5569]  7.7e-20 SSF47336
SSF47336   ACP-like
 [2018-2115]  1.7e-18 G3DSA:1.10.1200.10 [3754-3828]  5.2e-19 G3DSA:1.10.1200.10 [5489-5564]  2.5e-16 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   no description
IPR011032 GroES-like (Domain)
 [1408-1564]  1.1e-31 SSF50129
SSF50129   GroES-like
IPR013149 Alcohol dehydrogenase, C-terminal (Domain)
 [1557-1648]  3.8e-17 PF00107
PF00107   ADH_zinc_N
IPR013154 Alcohol dehydrogenase GroES-like (Domain)
 [1438-1496]  2.6e-07 PF08240
PF08240   ADH_N
IPR013968 Polyketide synthase, KR (Domain)
 [1734-1913]  7.5e-65 PF08659 [3474-3653]  1.6e-65 PF08659 [5208-5387]  1.6e-61 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [35-284]  2.2e-97 PF00109 [2108-2359]  4.9e-99 PF00109 [3847-4097]  5.2e-96 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [292-409]  2.7e-47 PF02801 [2367-2485]  2e-49 PF02801 [4105-4221]  2.2e-48 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [572-884]  1.6e-63 PF00698 [2645-2960]  3e-96 PF00698 [4376-4693]  1.6e-64 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [568-875]  2e-74 SSF52151 [2642-2932]  1.9e-63 SSF52151 [4372-4665]  1.2e-70 SSF52151
SSF52151   FabD/lysophospholipase-like
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [694-758]  1.4e-17 SSF55048 [2767-2832]  1e-19 SSF55048 [4497-4561]  3.3e-17 SSF55048
SSF55048   Probable ACP-binding domain of malonyl-CoA ACP transacylase
IPR016038 Thiolase-like, subgroup (Domain)
 [34-295]  1.5e-90 G3DSA:3.40.47.10 [296-462]  1.6e-64 G3DSA:3.40.47.10 [2116-2370]  2.7e-90 G3DSA:3.40.47.10 [2371-2537]  3.4e-66 G3DSA:3.40.47.10 [3849-4109]  2.9e-88 G3DSA:3.40.47.10 [4110-4272]  7.3e-65 G3DSA:3.40.47.10
G3DSA:3.40.47.10   no description
IPR016039 Thiolase-like (Domain)
 [27-406]  2.1e-103 SSF53901 [2101-2537]  5.1e-108 SSF53901 [3839-4219]  1.3e-102 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1510-1700]  4.2e-51 G3DSA:3.40.50.720 [1734-1920]  1.8e-35 G3DSA:3.40.50.720 [3739-3740]  1.1e-35 G3DSA:3.40.50.720 [5207-5388]  9.4e-34 G3DSA:3.40.50.720
G3DSA:3.40.50.720   no description
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [197-213]  PS00606 [2272-2288]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [572-865]  1.7e-126 SM00827 [2646-2941]  2.6e-112 SM00827 [4376-4674]  3e-131 SM00827
SM00827   Acyl transferase domain in polyketide syntha
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [2017-2089]  2.3e-30 SM00823 [3756-3828]  2.7e-33 SM00823 [5493-5565]  2.5e-30 SM00823
SM00823   Phosphopantetheine attachment site
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [930-1095]  8.3e-90 SM00826 [3006-3169]  9.4e-84 SM00826 [4739-4900]  1.9e-83 SM00826
SM00826   no description
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [37-462]  6.8e-229 SM00825 [2111-2537]  3.5e-233 SM00825 [3849-4273]  1.1e-226 SM00825
SM00825   Beta-ketoacyl synthase
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1734-1914]  3.3e-65 SM00822 [3474-3654]  1.1e-65 SM00822 [5208-5388]  1.8e-62 SM00822
SM00822   no description
IPR020843 Polyketide synthase, enoylreductase (Domain)
 [1418-1724]  1.4e-178 SM00829
SM00829   Enoylreductase
SignalP No significant hit
TMHMM No significant hit