close all open/close all

CDS information : Lydi_00150


close this sectionLocation

Organism
StrainTP-A0598 (=NBRC 110027)
Entry nameLydicamycin
Contig
Start / Stop / Direction77,520 / 88,508 / + [in whole cluster]
77,520 / 88,508 / + [in contig]
Location77520..88508 [in whole cluster]
77520..88508 [in contig]
TypeCDS
Length10,989 bp (3,662 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)polyketide synthase
GeneTPA0598_03_00790
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[26380643] Draft genome sequence of marine-derived Streptomyces sp. TP-A0598, a producer of anti-MRSA antibiotic lydicamycins. (Stand Genomic Sci. , 2015)

close this sectionPKS/NRPS Module

14 malonyl-CoA
15 malonyl-CoA
KS34..394
AT559..871
KR1157..1335
ACP1437..1507
KS1528..1905
AT2061..2378
DH2426..2590
ER2910..3215
KR3225..3405
ACP3508..3578

close this sectionSequence

selected fasta
>polyketide synthase [polyketide synthase]
MANEEKLREYLKRMTADLYETRQRLQDAQEKSHEPLAIVGMSCRFPGGVASPEDLWRLLD
AGGEGITGFPVDRGWDTEGLYDPTGRAEGTSYAKEGGFLHEAADFDPAFFGISPKDAAAV
DPQQRLLLETSWEALERAGIDPASLRGSRTGVFAGLMYHDYFGSTSSGSALSGRVAYNFG
FEGPAITVDTACSSSLVALHLAGHALRKGDCSLALVGGVTVMATPWTFIEFSRQRGLAAD
GRCKSFADAADGTGWAEGAGVLLVEKLSDARRNGHPVLAVVRGTAVNSDGASNGLSAPNG
PAQQRVIEQALVNAGLAPGQIDAVEAHGTGTTLGDPIEAQALLASYGQDRERPLWLGSVK
SNIGHTQAAAGVAGIMKMVLAMRHGVLPKTLHVDRPSTHVDWTAGAVELLTDAREWPRTG
QPRRAAVSSFGFSGTNAHVVLEQAEAVAAVGTDAAAGAESAAEPLPTAGPVPWVLSARSE
EALAAQAGRIASFAEGRPETTPADIGWSLVNTRSALEHRAVVLGADRDGLLSAARGLAAG
RRPAGVVADVVADGKLGVLFTGQGSQRPGMGRELYATYPVFARAFDEVCAAFDGRLPKPL
REVVHGASELLDQTQYTQAALFALEVALYRLTESWGLAPDLLMGHSIGEVTAAHVAGVWS
LPDAATLVAARGRLMQELSSGGAMVSVRATEDEVRPLLAGEDQVGLAAVNGPESVVLSGA
EDAVGRIAAELSSRGRKVKRLRVSHAFHSPLMEPMLDAFRAVAKGITYAEPRMPVVSNVT
GRLATARELCDPEYWVRHVREAVRFHDGLLAGHADGVTTFLELGPGGVLSAMGQDCLPGH
DTVRFLPALRENRTEPVALLEAVGGAYARGATVDWNPLLTGARRVDLPTYPFQRRRYWLD
EAEVMGEPDRPAAADDARFWDLVAREDLPELLHTLELDEDQPLGAILPALSAWRRRQEHE
STVDKWAYRISWKPVPTGAAALHGTWLLAGPDEDDPVAEALTAHGAHVVRLALGGGREEL
ATALAALDGEIAGVLARPTVTDALALVQALGDAGIGAPLWCVTSGAVSTGAADPLREPDL
AQVWGLGRTVALEQSDRWGGLIDLPAELDRTAAARLCAVLGGAGDEDQLAIRPAGVFARR
LVRARLDRDAAPWKPRGTVLITGGTGALGAASARWLAANGAEHLVLTSRRGPDAPGSTEL
AAELTELGARVTLAACDVADRESLARLLDGLPEPPSAVLHIAGTGGPVVPVTELGAADLD
GVLASKVAGAAHLDALLGDRQLDAFVLFSSVAGIWGSGGQAGYGAANAYLDALAEQRRAR
GLTATSVAWAPWGGGGLAEDAAVQDQLRQRGLPAMAPELAISALAAALGQDETCLTVADV
DWDRFIPGFTFARPSPLFAGVPEARGLLSGGDGPAVADSALRRELAGLTDADRDKALLDF
VRTQIADVLGYDSPELVDPARAFKDLGFDSLSAVEFRNRLTTASGLTLPATMIFDYPTPA
VLVRHLRDEITDSAGTPSVTPATVAASDEPIAIVGMGCRLPGGVRTPEQLWQLLAEGRDG
ITPFPADRGWDTEGMYDSDPDQAGASYVRHGGFIDGLAEFDADFFEISPREAISMDPQQR
LLLEVAWEAIEAAGIDPATVHGTDTGVFVGANGNDYMSVLAGAGQGPDGFLGTGTSYSVM
SGRVAYALGLEGPTMTIDSACSSSLVALHLAAAALRSGECSLALAGGVTLMTTPGSFIEF
SRLRGLAPDGRCKAFAEGADGTNWGEGVGVLLVERLSDAVRNGHPVLAVVRGSAINQDGA
SNGLTAPNGPSQARVIRQALTAAGLQASEVDAVEAHGTGTRLGDPIEAQALLSTYGAERD
VDRPLWLGSVKSNIGHTQAAAGVAGVIKMVLAMRHGLLPQTLHVDAPSTHVDWSSGAVEL
VTAPRAWPELDRPRRAGVSSFGFSGTNAHLILEQAPDLPAPPVDDAVADGPLPWVLSGKT
PQALAAQAARLAEHLTTVPDPAPGDLAWSLLTSRSAFEHRAAVIGTDLDDLRRGLASLAS
GAAGAEVVTGTATTGALAVMFTGQGAQRVGMGAGLHRRYPVFAQAFDEAAAELDRWLPRP
LREIVWAEPGSPDAALLDHTQYTQAALFAVEVALYRLLESWGVRPDRLVGHSIGEVVAAH
VAGVWSLPDACALVAARGRLMQELPAEGAMVSVRTTEDEVTALLAGREHEVGIAAVNGPA
SVVISGAEKAVLEVAATLAAAGVTTKRLAVSHAFHSPLMEPMLDAFRETVAGLTFRAPRM
EIVSNVTGRPLTAEEACSPDYWVGHVRGAVRFCDGVRALEAAGVRTFLEVGPDGVLSGMG
QECVTGEDTVLVPTLRRDRAEDGAAVTALARLRLRGVPVDWTAFFSGRGARRVDLPTYAF
QGERYWPRPSGTAGDVTAAGLGAAGHPLLGAAVAVAGSDEVLFTGRIGTHSHPWLADHAI
GDLVLLPGTAFVEMAIRAGDEVGCGLLEELTLAAPLALPARGAVRLQVVVGAADEDGRRA
LSVHSQPESDAAGQEDWTQHATGVLALAGATGAFAETAWPPAGAEPVDTADYYPRLAEAG
MNYGPVFQGLRAAWRRGQEVFAEVALPEAAAEDAGSFGLHPALLDAALHAAGLGSFFTDE
GGARLPFAWSGLTLHAAGAATLRVRIAPAGTDAVSVAAADETNAPVATVESLVLRRQDPA
ATVAAPSLPDSLYRIDWPTVAAEPAGTTTWATLGTLDEAPEKAVRYADLAALTAALDSGT
PAPEVVLVPCVGDTGVDELSDAVRELSGQMLKLAREWLADDRLENTTLAVVTRGAVAVHA
DEGIADLAAAPVWGLLRSAQSENPERIVLLDSDGSGGPDALAAALGSGEPQLAVRAGELR
TPRLASLASGGTLVPPARGPAWKLDVTSSGTFDNLALVPSDADRALVPGEVRIGVRAAGL
NFRDVMIALGMYPEKAAMGIEAAGVVLEVGPEVTAFAPGDRVIGMFAGAFGPVAITDSRM
LARIPDDWSYVRAASVPIVFSTAYYGLVELGGLQAGESVLVHNAAGGVGMAAVQLAQHLG
AEVFGTASTGKWDTLRASGLDEEHIASSRDLDFEEKFRRTTGGRGMDVVLDALAREFVDA
SLRLLPRGGRFLEMGKTDVRTPEEVAAAYPGVEYQAFDLMMGAGPQRVGEVLREVVRLLD
TGALRPIPVTTWDVRRAPDAFRYLAKARHTGKIVLTMPETLDEGGTVLVTGGTGTLGGLA
ARRLVREHGVRHLLLTSRTGRSADGAPELESELRALGAEVEIAACDAADRTALRELLAGI
PADRPLTAVVHTAGVLDDGVIGSLTPERLDTVLRPKVDAAVNLHELTAGQDLAAFVLYSA
AAGTFGGAGQGNYAAANVFLDALAAYRRANGLPATALAWGLWTETSGITRHLGEADVRRM
SRAGMPPLSTEEGMTLFDAALRADEPAMLPARLDVSVFRGAPAEAVPPLLRGLVRTPARR
TVAAATRSADDFAQRLTGLTAEEIDGVLLDFVREQAAAVLGHGSPAAVEPGRAFNEMGFD
SLTAVEFRNRLNGAAGLRLPATLVFDYPNAEVLAAHLKETLAPEAADPAAVVLGELERLE
SALAALSPDEGAGASITSRLQALTKAWEDRRSTAGPTDVKDRLQAASTDEVFAFINDELG
LS
selected fasta
>polyketide synthase [polyketide synthase]
ATGGCGAATGAGGAGAAGCTCCGCGAGTACCTCAAGCGGATGACGGCCGATCTCTACGAG
ACGCGTCAACGCCTTCAGGACGCCCAGGAGAAGAGCCATGAACCGCTCGCCATCGTGGGC
ATGAGCTGCCGGTTCCCGGGCGGGGTGGCCTCGCCCGAGGACCTGTGGCGGCTGCTCGAC
GCCGGTGGCGAGGGAATCACCGGATTCCCCGTCGACCGGGGCTGGGACACGGAGGGTCTG
TACGACCCGACGGGCCGGGCCGAGGGCACGTCGTACGCGAAGGAAGGCGGCTTCCTGCAC
GAGGCGGCCGACTTTGACCCCGCCTTCTTCGGGATCAGTCCCAAGGACGCGGCCGCGGTG
GACCCGCAGCAGCGGCTGCTCCTGGAGACCTCCTGGGAGGCCCTGGAACGGGCCGGGATC
GATCCGGCGAGCCTCCGTGGCAGCCGGACCGGGGTGTTCGCCGGGCTCATGTACCACGAC
TACTTCGGCAGCACGAGTTCCGGTTCCGCGCTCTCCGGCCGGGTCGCCTACAACTTCGGT
TTCGAGGGCCCCGCGATCACCGTGGACACCGCGTGCTCGTCGTCGCTGGTGGCGCTGCAT
CTGGCCGGACACGCCCTCCGTAAGGGCGACTGCTCGCTGGCCCTGGTCGGCGGAGTGACC
GTGATGGCCACCCCGTGGACCTTCATCGAGTTCTCCCGGCAGCGCGGGCTGGCCGCGGAC
GGCCGGTGCAAGTCCTTCGCGGACGCGGCCGACGGCACCGGCTGGGCCGAGGGTGCCGGT
GTGCTGCTGGTGGAGAAGCTCTCCGACGCCCGGCGGAACGGACACCCGGTCCTGGCCGTG
GTGCGCGGTACCGCGGTGAACTCCGACGGTGCCTCGAACGGGCTGAGCGCCCCGAACGGC
CCCGCCCAGCAACGGGTCATCGAACAGGCCCTGGTCAACGCGGGACTGGCTCCCGGCCAG
ATCGACGCGGTCGAGGCGCATGGCACCGGTACCACCCTCGGTGACCCCATCGAGGCGCAG
GCGCTGCTGGCGTCGTACGGGCAGGACCGGGAGCGGCCGCTGTGGCTCGGCTCGGTCAAG
TCGAACATCGGGCACACCCAGGCCGCCGCCGGGGTCGCCGGCATCATGAAGATGGTGCTG
GCCATGCGGCACGGCGTGCTGCCCAAGACGCTGCATGTGGACCGGCCCTCCACCCATGTG
GACTGGACCGCCGGTGCGGTGGAGCTGCTCACCGACGCCCGGGAGTGGCCGCGGACCGGG
CAGCCCCGGCGGGCCGCGGTGTCCTCCTTCGGGTTCAGCGGCACCAATGCGCATGTGGTG
CTGGAGCAGGCCGAAGCGGTGGCAGCCGTCGGGACCGACGCCGCGGCCGGGGCGGAGTCC
GCCGCGGAGCCGTTGCCGACCGCCGGGCCGGTGCCCTGGGTGCTGTCCGCCCGTTCCGAA
GAGGCGCTCGCCGCGCAGGCCGGCCGGATCGCGTCGTTCGCCGAGGGCCGGCCGGAGACC
ACGCCGGCGGACATCGGCTGGTCGCTGGTCAACACCCGCTCCGCGCTGGAACACCGCGCG
GTGGTCCTCGGCGCCGACCGGGACGGACTGCTGTCCGCCGCCCGCGGGCTGGCCGCCGGA
CGGCGCCCGGCCGGAGTGGTCGCCGATGTCGTCGCCGACGGCAAGCTCGGTGTGCTGTTC
ACCGGGCAGGGCTCCCAGCGGCCCGGGATGGGCCGGGAACTGTATGCGACGTACCCGGTG
TTCGCCCGCGCCTTCGACGAGGTCTGTGCCGCGTTCGACGGCCGGCTGCCGAAGCCGCTG
CGCGAGGTCGTGCACGGCGCGAGCGAACTCCTCGACCAGACGCAGTACACCCAGGCCGCC
CTGTTCGCCCTTGAAGTCGCGCTCTACCGGCTCACCGAATCCTGGGGTCTGGCACCGGAC
CTCCTGATGGGCCACTCCATCGGTGAGGTCACCGCCGCCCATGTGGCCGGAGTGTGGTCA
CTGCCGGACGCCGCCACCCTGGTGGCGGCCCGTGGCCGGCTGATGCAGGAACTCTCCTCC
GGCGGCGCCATGGTGTCGGTACGAGCCACCGAGGACGAGGTCCGCCCCCTGCTGGCGGGC
GAGGACCAGGTCGGTCTCGCGGCCGTCAACGGGCCCGAGTCCGTGGTGCTGTCCGGCGCC
GAGGACGCGGTCGGCCGGATCGCCGCGGAACTGTCGTCGCGCGGCCGCAAGGTGAAGCGG
CTGCGGGTCAGCCATGCCTTCCACTCACCGCTGATGGAACCCATGCTCGACGCCTTCCGC
GCGGTCGCGAAGGGCATCACCTACGCCGAGCCCCGGATGCCCGTGGTGTCCAACGTGACC
GGACGGCTCGCCACCGCCCGGGAACTGTGCGACCCCGAGTACTGGGTGCGGCACGTCCGC
GAGGCGGTGCGCTTCCACGACGGCCTGCTCGCCGGGCACGCCGACGGTGTGACCACCTTC
CTCGAACTCGGGCCCGGCGGGGTGCTCTCCGCCATGGGCCAGGACTGCCTGCCCGGTCAC
GACACCGTCCGGTTCCTGCCCGCCCTGCGCGAGAACCGCACCGAGCCGGTGGCACTGCTG
GAGGCGGTGGGCGGGGCGTATGCCCGTGGCGCCACCGTGGACTGGAACCCGCTGCTCACC
GGAGCCCGGCGGGTCGATCTGCCCACCTATCCCTTCCAGCGGCGGCGGTACTGGCTGGAC
GAAGCGGAGGTCATGGGCGAGCCGGACCGTCCGGCCGCCGCGGACGACGCCCGGTTCTGG
GACCTGGTCGCCCGCGAGGACCTCCCCGAACTGCTGCACACCCTGGAGCTGGACGAGGAC
CAGCCGCTCGGCGCGATCCTGCCGGCGCTGTCCGCCTGGCGCCGGCGTCAGGAGCACGAG
TCCACGGTGGACAAGTGGGCCTACCGGATCTCCTGGAAGCCGGTGCCGACCGGGGCCGCC
GCGCTCCACGGCACCTGGCTCCTCGCCGGACCGGACGAGGACGACCCCGTCGCGGAGGCA
CTCACCGCGCACGGCGCCCACGTGGTACGTCTTGCCCTCGGCGGCGGCCGCGAGGAACTC
GCCACCGCCCTGGCGGCACTCGACGGCGAGATCGCCGGAGTACTGGCCCGGCCCACGGTC
ACCGACGCCCTGGCCCTGGTACAGGCACTGGGCGACGCGGGTATCGGCGCGCCCCTGTGG
TGTGTCACCAGCGGGGCGGTGTCGACCGGCGCGGCGGACCCGCTGCGGGAGCCGGACCTC
GCCCAGGTATGGGGGCTCGGCCGGACCGTCGCCCTGGAACAGTCCGACCGCTGGGGCGGA
CTCATCGACCTGCCCGCCGAACTGGACCGGACCGCCGCGGCCCGGCTCTGCGCCGTCCTC
GGCGGCGCCGGAGACGAGGACCAGCTCGCGATCAGGCCGGCCGGGGTGTTCGCCCGCCGG
CTGGTCCGCGCCCGCCTCGACCGGGACGCCGCACCCTGGAAGCCCCGCGGCACCGTGCTG
ATCACCGGCGGTACCGGCGCGCTGGGCGCCGCGTCCGCCCGCTGGCTCGCCGCCAACGGG
GCCGAGCACCTGGTGCTCACCAGCCGCCGCGGCCCGGACGCCCCCGGCAGCACCGAACTC
GCCGCGGAACTCACCGAGTTGGGTGCCCGGGTCACCCTCGCCGCCTGCGACGTGGCCGAC
CGGGAAAGCCTCGCCCGGCTGCTCGACGGCCTGCCCGAACCCCCCTCGGCGGTGCTGCAC
ATCGCCGGCACCGGCGGTCCGGTCGTGCCGGTCACCGAGCTCGGCGCAGCGGACCTCGAC
GGGGTCCTCGCCTCCAAGGTCGCCGGTGCGGCCCATCTGGACGCCCTCCTCGGGGACCGG
CAGCTGGACGCCTTTGTGCTGTTCTCCTCCGTCGCCGGGATCTGGGGCAGCGGCGGCCAG
GCCGGTTACGGCGCGGCCAACGCCTACCTCGACGCCCTCGCCGAACAGCGCCGGGCCCGC
GGACTCACCGCCACCTCGGTGGCCTGGGCCCCCTGGGGAGGGGGAGGCCTCGCGGAGGAC
GCCGCCGTACAGGACCAGCTCCGTCAGCGCGGACTGCCCGCGATGGCGCCGGAACTGGCC
ATCAGCGCGCTGGCCGCGGCGCTCGGCCAGGACGAGACCTGTCTGACCGTCGCCGATGTC
GACTGGGACCGGTTCATCCCCGGCTTCACCTTCGCCCGGCCGAGCCCGCTGTTCGCCGGG
GTGCCCGAGGCACGCGGCCTGCTGAGCGGGGGTGACGGCCCGGCGGTCGCCGATTCGGCG
CTGCGCCGGGAGCTCGCCGGGCTGACCGACGCCGACCGGGACAAGGCACTGCTGGACTTC
GTCCGCACCCAGATAGCGGACGTCCTCGGCTACGACAGCCCCGAACTCGTCGATCCGGCA
CGGGCGTTCAAGGATCTGGGCTTCGACTCGCTGAGCGCGGTGGAGTTCCGCAACCGGCTC
ACCACGGCGTCGGGGCTGACCCTGCCGGCCACGATGATCTTCGACTATCCGACCCCGGCG
GTCCTCGTCCGCCATCTGCGGGACGAGATCACGGACTCCGCCGGCACCCCGTCGGTCACC
CCGGCCACCGTCGCGGCGTCCGACGAGCCCATCGCCATCGTCGGCATGGGCTGCCGGCTG
CCCGGCGGGGTACGCACCCCGGAGCAGCTGTGGCAGCTCCTGGCCGAGGGGCGGGACGGG
ATCACCCCGTTCCCCGCCGACCGGGGCTGGGACACCGAGGGGATGTACGACAGCGACCCC
GACCAGGCCGGCGCCAGCTATGTGCGGCACGGCGGGTTCATCGACGGCCTGGCCGAATTC
GACGCCGACTTCTTCGAGATCAGCCCGCGTGAGGCGATCTCGATGGACCCGCAGCAGCGG
CTGCTGCTCGAAGTGGCCTGGGAGGCCATCGAGGCCGCCGGGATCGACCCGGCGACCGTG
CACGGCACCGACACCGGCGTGTTCGTCGGCGCCAACGGCAACGACTACATGAGCGTCCTG
GCCGGCGCCGGACAGGGGCCCGACGGGTTCCTGGGCACCGGCACCAGCTACAGCGTGATG
TCCGGCCGGGTCGCCTACGCCCTCGGTCTCGAAGGCCCCACGATGACCATCGACAGCGCC
TGCTCCTCCTCGCTGGTGGCGCTGCATCTCGCGGCCGCCGCCCTGCGGTCGGGGGAGTGC
TCGCTGGCCTTGGCCGGCGGGGTGACGCTGATGACCACCCCCGGGTCCTTCATCGAGTTC
AGCCGGCTGCGCGGACTCGCCCCCGATGGCCGGTGCAAGGCCTTCGCCGAGGGTGCCGAC
GGCACCAACTGGGGTGAGGGCGTCGGTGTCCTGCTCGTCGAGCGGCTCTCCGACGCGGTG
CGCAACGGCCATCCGGTGCTCGCCGTGGTCCGGGGCTCCGCGATCAACCAGGACGGTGCC
TCGAACGGCCTGACCGCGCCCAACGGGCCCTCCCAGGCCCGGGTGATCCGGCAGGCCCTC
ACCGCCGCCGGTCTCCAGGCGTCCGAGGTGGACGCGGTGGAGGCGCACGGCACCGGCACC
CGCCTCGGCGACCCCATCGAGGCTCAGGCCCTGCTCAGCACGTACGGGGCGGAGCGTGAC
GTCGACCGGCCGCTGTGGCTCGGTTCGGTGAAGTCGAACATCGGGCACACCCAGGCCGCC
GCCGGGGTCGCCGGCGTGATCAAGATGGTGCTCGCCATGCGGCACGGGCTGCTGCCGCAG
ACCCTGCACGTGGACGCGCCCTCGACCCATGTGGACTGGTCCAGCGGCGCGGTGGAACTG
GTCACCGCGCCCCGGGCCTGGCCCGAACTGGACCGGCCCCGGCGGGCCGGGGTGTCCTCC
TTCGGCTTCAGCGGCACCAACGCCCATCTGATCCTGGAGCAGGCACCGGACCTTCCGGCG
CCTCCCGTGGACGACGCGGTGGCGGACGGCCCGTTGCCGTGGGTGCTCTCCGGCAAGACC
CCGCAGGCGCTGGCCGCCCAGGCCGCACGGCTCGCGGAGCACCTCACGACCGTCCCGGAC
CCCGCGCCCGGCGACCTCGCCTGGTCGCTGCTCACCTCCCGGTCGGCTTTCGAGCACCGG
GCCGCGGTGATCGGCACGGACCTCGACGACCTCCGGCGCGGACTGGCGTCGCTCGCCTCC
GGTGCCGCCGGGGCCGAGGTGGTGACCGGCACGGCCACCACCGGTGCGCTCGCGGTGATG
TTCACCGGCCAGGGCGCTCAGCGGGTCGGCATGGGCGCCGGACTCCACCGCCGTTACCCG
GTCTTCGCGCAGGCCTTCGACGAGGCCGCCGCCGAACTGGACCGGTGGCTGCCCCGCCCG
CTCCGGGAGATCGTCTGGGCCGAACCCGGCTCCCCGGACGCCGCGTTACTGGACCACACT
CAGTACACCCAGGCCGCCCTGTTCGCGGTCGAGGTCGCCCTGTACCGGCTGCTGGAGTCC
TGGGGCGTCCGCCCCGACCGGCTGGTCGGCCACTCCATCGGTGAAGTGGTCGCGGCCCAT
GTGGCCGGGGTGTGGTCGCTGCCGGACGCCTGTGCCCTGGTCGCCGCGCGCGGCCGGCTG
ATGCAGGAACTGCCCGCCGAGGGTGCCATGGTGTCGGTCCGCACCACCGAGGACGAGGTC
ACCGCACTGCTCGCCGGGCGCGAGCACGAGGTCGGTATCGCGGCCGTGAACGGCCCCGCC
TCCGTGGTCATCTCGGGAGCGGAGAAGGCCGTACTGGAGGTCGCGGCAACCCTCGCCGCC
GCGGGGGTCACCACCAAGCGCCTGGCCGTCAGCCATGCCTTCCACTCCCCGCTGATGGAA
CCGATGCTGGACGCCTTCCGGGAGACCGTGGCCGGGCTGACCTTCCGGGCACCGCGGATG
GAGATCGTGTCCAACGTGACCGGCCGGCCGCTCACCGCGGAGGAGGCCTGCTCGCCGGAC
TACTGGGTCGGCCATGTCCGCGGTGCGGTGCGGTTCTGCGACGGGGTGCGCGCCCTGGAG
GCCGCCGGGGTGCGGACCTTCCTCGAAGTCGGCCCGGACGGCGTGCTGTCCGGCATGGGC
CAGGAGTGTGTGACCGGCGAGGACACCGTGCTGGTGCCGACACTGCGCCGGGACCGCGCC
GAGGACGGGGCCGCGGTGACCGCGCTGGCCCGGCTGCGGCTGCGGGGCGTCCCGGTCGAC
TGGACGGCCTTCTTTTCCGGACGCGGTGCGCGGCGGGTGGACCTGCCCACCTACGCCTTC
CAGGGCGAGCGGTACTGGCCGCGGCCGTCCGGCACGGCCGGTGATGTCACCGCCGCCGGA
CTGGGCGCCGCCGGCCATCCGCTGCTCGGCGCCGCCGTCGCGGTGGCCGGATCCGACGAG
GTCCTGTTCACCGGGCGGATCGGCACCCACAGCCACCCCTGGCTCGCCGACCACGCCATC
GGCGACCTGGTCCTGCTGCCCGGCACCGCGTTCGTCGAGATGGCGATCCGCGCCGGTGAC
GAGGTCGGCTGCGGTCTGCTGGAGGAACTGACGCTGGCGGCGCCCCTGGCGCTGCCCGCA
CGGGGCGCGGTCCGGCTCCAGGTCGTGGTCGGTGCCGCGGACGAGGACGGCCGGCGCGCG
CTGAGCGTGCACTCCCAGCCGGAGTCGGACGCCGCCGGGCAGGAGGACTGGACCCAGCAC
GCCACCGGTGTCCTGGCTCTCGCCGGCGCCACCGGCGCGTTCGCCGAAACGGCCTGGCCC
CCGGCCGGCGCCGAGCCCGTCGACACCGCGGACTACTACCCGCGGCTGGCCGAGGCCGGC
ATGAACTACGGCCCGGTCTTCCAGGGCCTGCGGGCGGCCTGGCGGCGTGGCCAGGAGGTC
TTCGCCGAGGTCGCACTGCCCGAGGCGGCGGCCGAGGACGCCGGTTCCTTCGGGCTGCAT
CCCGCCCTGCTGGACGCCGCGCTGCACGCGGCCGGGCTGGGCTCCTTCTTCACCGACGAA
GGGGGCGCCCGGCTCCCGTTCGCCTGGAGCGGTCTGACGCTGCACGCGGCCGGCGCCGCC
ACCTTGCGGGTGCGGATCGCACCGGCCGGTACGGACGCCGTCTCGGTGGCCGCAGCGGAC
GAGACGAACGCGCCGGTCGCCACCGTGGAGTCCCTGGTCCTGCGCAGGCAGGACCCGGCC
GCCACGGTCGCGGCGCCGTCCCTGCCCGACTCGCTGTACCGGATCGACTGGCCGACGGTC
GCCGCCGAGCCCGCCGGCACCACGACCTGGGCGACCCTCGGAACGCTCGACGAGGCACCG
GAGAAGGCCGTTCGGTACGCCGACCTGGCCGCGCTGACCGCCGCGCTCGACAGTGGCACC
CCGGCGCCTGAGGTGGTACTCGTCCCCTGCGTCGGCGACACCGGTGTCGACGAACTCTCC
GATGCGGTACGGGAGTTGAGCGGCCAAATGCTGAAGCTGGCCCGGGAGTGGCTGGCCGAC
GACCGCCTGGAGAACACGACACTGGCCGTGGTCACCCGCGGCGCGGTCGCGGTGCACGCC
GACGAGGGCATCGCGGATCTCGCCGCCGCCCCGGTCTGGGGCCTGCTCCGGTCCGCGCAG
TCGGAGAACCCGGAGCGGATCGTCCTGCTCGACTCGGACGGTTCGGGCGGCCCGGACGCG
CTCGCCGCGGCGCTCGGCTCCGGAGAACCCCAACTGGCCGTGCGTGCTGGCGAGTTGCGG
ACACCGCGACTGGCGTCGCTGGCCTCCGGCGGCACGCTGGTGCCACCGGCCCGGGGCCCG
GCCTGGAAGCTGGATGTCACCAGCTCCGGTACGTTCGACAACCTCGCGCTGGTGCCCTCG
GACGCGGACCGTGCCCTGGTCCCCGGCGAGGTCCGGATCGGGGTGCGCGCGGCCGGGCTG
AACTTCCGCGACGTCATGATCGCCCTCGGGATGTACCCGGAGAAGGCGGCCATGGGCATC
GAGGCGGCCGGCGTCGTCCTCGAAGTCGGCCCCGAGGTCACCGCCTTCGCCCCCGGTGAC
CGCGTGATCGGCATGTTCGCCGGCGCGTTCGGCCCGGTGGCCATCACCGACAGCCGGATG
CTGGCGCGGATCCCCGACGACTGGTCCTACGTCCGGGCCGCCTCGGTGCCCATCGTCTTC
TCCACCGCCTACTACGGCCTGGTGGAACTCGGCGGACTCCAGGCCGGGGAGTCGGTGCTG
GTGCACAACGCGGCCGGCGGTGTCGGCATGGCCGCCGTACAGCTGGCACAGCACCTCGGC
GCGGAGGTCTTCGGCACGGCCAGCACCGGAAAGTGGGACACCCTGCGCGCGAGCGGTCTC
GACGAGGAGCACATCGCCTCCTCCCGTGACCTCGACTTCGAGGAGAAGTTCCGCCGCACC
ACCGGCGGCCGCGGAATGGATGTCGTCCTGGACGCGCTGGCCCGCGAGTTCGTGGACGCC
TCGCTGCGGCTGCTGCCCCGCGGCGGCCGGTTCCTGGAAATGGGCAAGACCGATGTGCGC
ACCCCCGAGGAGGTCGCGGCCGCCTACCCCGGTGTGGAGTACCAGGCCTTCGACCTGATG
ATGGGCGCCGGTCCGCAGCGGGTCGGCGAGGTCCTGCGGGAGGTGGTGCGCCTGCTCGAC
ACCGGTGCGCTGCGGCCGATCCCGGTCACCACCTGGGATGTGCGACGGGCTCCGGACGCC
TTCCGGTACCTCGCCAAGGCCCGGCACACCGGCAAGATCGTGCTGACCATGCCGGAGACC
CTCGACGAAGGGGGCACGGTCCTCGTCACCGGCGGCACCGGCACCCTCGGCGGACTGGCC
GCCCGGCGCCTGGTGCGCGAACACGGCGTCCGGCACCTCCTGTTGACCAGCCGCACCGGC
CGGTCGGCGGACGGCGCACCGGAGCTGGAGAGCGAACTGCGCGCACTCGGCGCCGAGGTG
GAGATCGCGGCCTGCGACGCGGCCGACCGTACGGCGCTGCGCGAACTGCTCGCCGGCATC
CCCGCCGACCGTCCGCTGACCGCGGTGGTGCACACCGCCGGAGTCCTGGACGACGGTGTG
ATCGGCTCGCTGACCCCGGAACGGCTCGACACGGTGCTGCGGCCCAAGGTGGACGCCGCG
GTGAATCTGCACGAGCTCACCGCCGGCCAGGACCTCGCCGCCTTCGTCCTGTACTCCGCC
GCCGCCGGCACCTTCGGCGGCGCCGGGCAGGGCAACTACGCGGCGGCGAATGTGTTCCTG
GACGCGCTGGCCGCCTACCGGCGCGCCAACGGCCTGCCCGCCACCGCGCTGGCCTGGGGC
CTGTGGACGGAGACCAGCGGCATCACCCGGCACCTCGGTGAGGCCGATGTCCGGCGGATG
AGCCGGGCCGGAATGCCCCCGCTGTCCACGGAAGAGGGCATGACGCTCTTCGACGCGGCA
CTGCGGGCCGACGAACCGGCGATGCTGCCGGCCCGGCTGGACGTCTCGGTGTTCCGCGGC
GCCCCCGCCGAGGCCGTACCCCCACTGCTGCGCGGGCTGGTGCGGACGCCCGCCCGGCGG
ACGGTGGCGGCGGCCACCCGCTCGGCGGACGACTTCGCCCAGCGGCTGACCGGCCTGACC
GCCGAGGAGATCGACGGCGTCCTGCTGGACTTCGTCCGGGAACAGGCCGCGGCCGTCCTC
GGCCACGGCTCGCCGGCCGCGGTGGAACCGGGCCGGGCGTTCAACGAGATGGGCTTCGAC
TCGCTGACCGCGGTCGAGTTCCGCAACCGGCTGAACGGGGCCGCCGGGCTCCGGCTGCCC
GCCACGCTGGTGTTCGACTACCCCAACGCGGAGGTGCTGGCGGCGCATCTCAAGGAGACG
CTGGCCCCCGAGGCCGCCGATCCGGCCGCCGTGGTGCTCGGCGAACTCGAACGGCTGGAG
AGCGCCCTCGCCGCGCTCTCCCCGGACGAGGGCGCCGGAGCCTCCATCACCAGCCGGTTG
CAGGCCCTCACCAAAGCCTGGGAGGACCGGCGGTCCACGGCCGGCCCGACCGATGTCAAG
GACAGGCTCCAAGCGGCGAGCACCGACGAGGTCTTCGCGTTCATCAACGACGAACTCGGA
CTCTCCTGA
[14] KS34..394
[14] AT559..871
[14] malonyl-CoA745..749
[14] KR1157..1335
[14] ACP1437..1507
[15] KS1528..1905
[15] AT2061..2378
[15] malonyl-CoA2252..2256
[15] DH2426..2590
[15] ER2910..3215
[15] KR3225..3405
[15] ACP3508..3578
[14] KS100..1182
[14] AT1675..2613
[14] malonyl-CoA2233..2247
[14] KR3469..4005
[14] ACP4309..4521
[15] KS4582..5715
[15] AT6181..7134
[15] malonyl-CoA6754..6768
[15] DH7276..7770
[15] ER8728..9645
[15] KR9673..10215
[15] ACP10522..10734

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [745-862]  1.6e-75 G3DSA:3.40.366.10 [2252-2366]  6.6e-77 G3DSA:3.40.366.10
G3DSA:3.40.366.10   no description
IPR009081 Acyl carrier protein-like (Domain)
 [1437-1507]  20.116 PS50075 [3508-3578]  18.336 PS50075
PS50075   ACP_DOMAIN
 [1440-1506]  6.9e-12 PF00550 [3511-3577]  6.3e-09 PF00550
PF00550   PP-binding
 [1430-1545]  4.7e-28 SSF47336 [3500-3595]  4.2e-21 SSF47336
SSF47336   ACP-like
 [1435-1511]  1.3e-20 G3DSA:1.10.1200.10 [3508-3582]  1.8e-17 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   no description
IPR011032 GroES-like (Domain)
 [2901-3045]  1.6e-32 SSF50129
SSF50129   GroES-like
IPR013154 Alcohol dehydrogenase GroES-like (Domain)
 [2928-2986]  7.3e-09 PF08240
PF08240   ADH_N
IPR013968 Polyketide synthase, KR (Domain)
 [1157-1334]  3.4e-58 PF08659 [3225-3404]  1.9e-59 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [34-270]  5.1e-89 PF00109 [1528-1779]  9.1e-98 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [278-394]  1.1e-48 PF02801 [1787-1905]  5.5e-49 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [559-871]  1.5e-63 PF00698 [2061-2378]  1.5e-63 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [4-34]  3.1e-06 SSF101173
SSF101173   Docking domain B of the erythromycin polyketide synthase (DEBS)
 [1-27]  1.4e-12 PF08990
PF08990   Docking
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [555-845]  1e-72 SSF52151 [2056-2373]  4.7e-73 SSF52151
SSF52151   FabD/lysophospholipase-like
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [680-744]  4.3e-17 SSF55048 [2186-2251]  1.4e-16 SSF55048
SSF55048   Probable ACP-binding domain of malonyl-CoA ACP transacylase
IPR016038 Thiolase-like, subgroup (Domain)
 [37-282]  6e-81 G3DSA:3.40.47.10 [283-445]  7.1e-64 G3DSA:3.40.47.10 [1531-1791]  1.1e-92 G3DSA:3.40.47.10 [1792-1957]  3.8e-65 G3DSA:3.40.47.10
G3DSA:3.40.47.10   no description
IPR016039 Thiolase-like (Domain)
 [26-446]  5.9e-100 SSF53901 [1521-1957]  3.2e-105 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1157-1370]  1.5e-31 G3DSA:3.40.50.720 [2999-3191]  4.3e-49 G3DSA:3.40.50.720 [3223-3437]  1.4e-32 G3DSA:3.40.50.720
G3DSA:3.40.50.720   no description
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [183-199]  PS00606 [1692-1708]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [559-853]  4.4e-123 SM00827 [2060-2359]  2.5e-127 SM00827
SM00827   Acyl transferase domain in polyketide syntha
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1438-1510]  1e-30 SM00823 [3509-3581]  4.4e-30 SM00823
SM00823   Phosphopantetheine attachment site
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [2426-2590]  3.4e-85 SM00826
SM00826   no description
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [36-446]  9.6e-207 SM00825 [1531-1957]  5.4e-227 SM00825
SM00825   Beta-ketoacyl synthase
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1157-1335]  1.3e-45 SM00822 [3225-3405]  4.8e-56 SM00822
SM00822   no description
IPR020843 Polyketide synthase, enoylreductase (Domain)
 [2910-3215]  5e-183 SM00829
SM00829   Enoylreductase
SignalP No significant hit
TMHMM No significant hit