close all open/close all

CDS information : Lydi_00160


close this sectionLocation

Organism
StrainTP-A0598 (=NBRC 110027)
Entry nameLydicamycin
Contig
Start / Stop / Direction88,545 / 98,342 / + [in whole cluster]
88,545 / 98,342 / + [in contig]
Location88545..98342 [in whole cluster]
88545..98342 [in contig]
TypeCDS
Length9,798 bp (3,265 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)polyketide synthase
GeneTPA0598_03_00800
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[26380643] Draft genome sequence of marine-derived Streptomyces sp. TP-A0598, a producer of anti-MRSA antibiotic lydicamycins. (Stand Genomic Sci. , 2015)

close this sectionPKS/NRPS Module

16 methylmalonyl-CoA
17 malonyl-CoA
KS34..409
AT573..889
DH939..1102
KR1425..1605
ACP1709..1779
KS1800..2176
AT2329..2642
kr2950..3112
ACP3191..3261

close this sectionSequence

selected fasta
>polyketide synthase [polyketide synthase]
MADEEKLVDYLKRVAADLHDTRQRLREAEEKGRQPLAIIGMNCRYPGAANPEQLWDLVAA
GGDPISDFPADRGWDTDELYDADPEKSGKSYVKQGGFVYDAIDFDAAFFGISPREALAMD
PQQRVVLEAAWAAFEDARIDPSSVRGSDTGVFFGASGAEYVPVIQQLPDASEGYTMTGVA
SSVLSGRVSYSFGFEGPAVTVDTACSSSLVALHMAAQALRQGECSLALAGGVTVMGTPGV
FTSFSRQRGLSPDGRCKAFAAGADGTGWAEGVGVVLVERLSDALRNGHPVLAVLRGSAVN
QDGASNGLTAPNGPSQIRVIRRALENAGITAAQVDAVEAHGTGTTLGDPIEAQALLATYG
KARTGERPLWLGSVKSNIGHAQQAAGIAGVIKMVMALRHRVLPKTLHVDAPTPHVDWESG
AVELLTEAKPWESADHPRRAGVSSFGISGTNVHLILEEAPAAEAVPPAAEEAPARTPGLA
ATGTVPWILSGATAGALRAQAARLRAFVADRPELDPATVGYSLATTRAALEHRAVVVGAD
HTELLGGLTALEHGEPAGNLVEGIAGSRGKVAFLFPGQGSQWAGMAVELLDTAPVFAARI
RECETALSAFTDWSLTDVLRGAKGAPGFDRVDVVQPALWAVMVSLAALWQSCGVTPSAVV
GHSQGEIAAACVAGALSLEDAARVVALRSKTLIELAGHGGMVSVPLPLDQVEERLRAWGE
RLSVAAVNGPASVVVSGEPQALQELLDGCEADGVRARRIEVDYASHSAQVEQIRERLLEV
LAPVRPRAADIPVYSTLTGDWLDTTTMDADYWYRSLRQTVLFEPAVRGLLDAGYGTLIEV
SAHPVLALGVQDTIEAAGGSALVTGSLRRDEGGVARFLTSLGQVHAHGQSPDWAAVFAGA
AHGTVALPTYAFERQRYWPKGTLTAAGDAAGFGLSAARHPLLGAVVTLADDEGVLFTGRL
SLSTHAWLADHVVAGRPVLPGTAFVELAVRAGDEVGCEVLEELTLAAPLVLPDRGGIRLQ
LAVGGPDAAGRRELSVRSRPEDAPDEEPWTTHATGTLATGAGAVGPRAESWPPEGAEPVE
CDGLYERFEGTGLSYGPVFQGLRAVWRRGGELFAEVALPEAAEDEGAAFGLHPALLDAAL
HPLALGGFVEDGSGDRPWLPFAWSGVRLHAAGAGTVRVRLSPTGPNALSVTVADATGAPV
ASVASLMLRQLTSETLDGTGPTFHDALFRVDWTPAPVPAEVPAGTVALLGAAGPDHRAAL
EAAGSRVDEYPELAALLRAMDAGAPVPDAVLVSCVPPEAPEVTAAVREATGRLLQLAQDW
LAEERFADTRLVIATQGAVATEPGADLTDLVHAPVWGLLRTAQSEHPGRFVLLDTDGLET
SARVLPAALALGADQLALRSGEIRLPRLARMAVSAAPAPEFTPGGTVLITGGTGTLGALF
ARHLVTEHGVRHLLLTSRSGHTAKGAAALTAELRELGAEVEIAACDAADRTALRELLAAI
PADRPLTGVISAAGTLDDGVLESLNQERLDAVMRPKVDAAWHLHELTRDLDLAAFVVFSS
AAGVLGGSGQANYAAANAFVDALAAHRRAAGLPALSLAWGRWTETSGLTEALDEAALARM
SRSGMTGLSTEQGVALFDAARAAGDALLVPARLDLAALRQQAGSGMVPELLRGLVRTPGR
RQVDGGAAATSELRERLTGMSAAERDRTLLDLVRAQVAAVLGYAGPQAVESTRPFKEIGF
DSLTAVELRNRLGAAVGLRLPATLVFDYPTPLELAGFVRDELLGAAAGTATGAPAAVRAD
EPIAIIGMSCRYPGGVDSPEKLWQLLTSGTDAVSAFPADRGWDMERLFDPDPDHPGTSYC
TEGGFLYDAARFDAGFFGISPKEALAMDPQQRLLLETSWETFERAGIDPATLKGSGTGVF
AGVMYNDYGMLTAASEQLDGYVGVGVAGGAVSGRISYTFGLEGPAVTVDTACSSSLVALH
LAVQALRQGECSLALAGGVSVMATPGTFIDFSRQRGLAPDGRCKSFADAADGAGWAEGAG
VLLVERLSDAVRNGHPVLAVVRGSAVNQDGASNGMTAPNGPSQQRLIRQALANARLNADQ
IDAVEAHGTGTTLGDPIEAQALLATYGQDRPEDHPMWLGSIKSNIGHTQAAAGVAGVMKM
VLAMQHGVLPRTLHVDRPSTHVDWESGAVELLTEAREWPETGQPRRAAVSSFGISGTNAH
LILEQPSAARTPAAAGTGPAPAVLPWVLSAHSAQALRAQAGRLAALAEGDPDPVDVGFSL
VSTRSALRHRAVLVGDRAALLTGARALAAGTHPAGAVSGVAGEGRIGMLFTGQGAQRLGM
GRELHAAHPVFARAWDEVCAAFDALLPRPLREVVWAGPGTPEAALLDQTQYAQAALFAVE
VALFRLVESLGVVPDALLGHSIGEVTAAHLAGVWSLADAAKLVAARGRLMQSLPAGGVMI
AVRAPEDVVLPLLSGQVSIAAVNGPEAVVLSGAEAAVTELAATLADKGYRTKQLRVSHAF
HSPLMGPVLDEFRTVAESLTYAEPGIPVVSNLTGRLAEPDQLRDPGYWVRHVREAVRFHD
GMQALHTEGLDTFLELGPGGVLSAMGQESLPGGEFLPALRKDRAEDEALLQALAGAYVRG
ATVDWLPLCGGGRRVALPTYAFQRQRYWPEADGPSGEGRPDASDPVESRFWELVEREDLG
ALLRTLDLDENQPIGALLPALSALRRGESAVDGTRYRADWHAVSELPTAELSGTWALLVP
EQHLEGDCARSVAEALRAHGAEVRQLTVTGADAGRERLTGLLAGLPAGIAGVVSLWALDE
QPHPEHPSVPSGVAGTMALSQALDEAAPGAPLWSLTRGAVSLTRTGRTAGTAAALVWGLG
RAVAAARPGHRGGLIDLPETLDARQGAWLAQLLADADGEDELALRPSGVFARRLGHAGRG
AAHRPWRPTGTALLAGELGAAGAPVARWLARNGAAHLLVPPALAGESLGVPVTVIDEALT
DREAVARLLGRVPAEHPLSTVVHGIGSAEDQPVGSATVAQFGQVLERAVHESEMLHELAR
DAAAFVLLAPAASTWGDPSRAAVTAAGAYREELVRRRRAEGLSGTVLCWDGALSPESVFV
RAVECGEQSVTVAEADWAELAVTRTGSLLRALPEVRRPAQEPAAETGDEVDPEALRAYLK
ELDAAGRQETLLEIARGVAARALGHESAAAVEPDLDFLDAGFNSLSAVEFRNALNRITGL
SLPAALVYDYPTPNAVVEFLESELA
selected fasta
>polyketide synthase [polyketide synthase]
ATGGCGGATGAAGAGAAGCTGGTCGACTATCTCAAGCGGGTCGCGGCTGATCTGCACGAC
ACCCGGCAGCGCCTGCGCGAGGCCGAGGAGAAGGGCCGGCAGCCGCTCGCGATCATCGGC
ATGAACTGCCGCTACCCGGGGGCGGCCAACCCGGAGCAGCTCTGGGATCTGGTCGCCGCC
GGTGGGGACCCGATCTCCGACTTCCCCGCCGACCGCGGCTGGGACACCGACGAGCTGTAC
GACGCCGACCCGGAGAAATCCGGCAAGAGCTATGTGAAACAAGGCGGCTTCGTCTACGAC
GCGATCGACTTCGACGCCGCGTTCTTCGGCATCAGCCCGCGCGAGGCGCTCGCCATGGAC
CCCCAGCAGCGGGTGGTCCTGGAAGCCGCCTGGGCGGCCTTCGAAGACGCGCGGATCGAC
CCGTCCAGTGTGCGGGGCAGCGATACCGGGGTCTTCTTCGGTGCCAGCGGCGCCGAGTAC
GTCCCGGTGATCCAGCAGCTCCCGGACGCGTCCGAGGGCTACACGATGACCGGCGTGGCC
AGCAGCGTGCTGTCCGGCCGGGTCTCGTACTCCTTCGGCTTCGAGGGCCCCGCGGTGACC
GTGGACACCGCCTGTTCGTCCTCGCTGGTCGCCCTGCACATGGCGGCCCAGGCACTACGG
CAGGGGGAGTGCTCCCTGGCGCTGGCCGGCGGGGTCACGGTGATGGGCACCCCCGGGGTG
TTCACCAGCTTCTCCCGGCAGCGCGGACTGTCCCCGGACGGCCGCTGCAAGGCCTTCGCG
GCCGGCGCCGACGGCACCGGCTGGGCGGAGGGCGTCGGGGTGGTGCTCGTCGAGCGGCTC
TCCGACGCGCTCCGCAACGGGCATCCGGTGCTCGCGGTGCTGCGCGGTTCCGCGGTGAAC
CAGGACGGCGCCTCGAACGGCCTGACCGCGCCCAACGGGCCGTCCCAGATACGGGTCATC
CGCCGGGCCCTGGAGAACGCGGGCATCACCGCGGCCCAGGTCGACGCGGTCGAGGCGCAC
GGCACCGGCACCACCCTCGGTGACCCCATCGAGGCGCAGGCGCTGCTCGCCACGTACGGC
AAGGCACGGACCGGGGAACGGCCGCTGTGGCTCGGCTCGGTCAAGTCCAACATCGGGCAC
GCCCAGCAGGCCGCCGGTATCGCCGGTGTGATCAAGATGGTCATGGCGCTGCGCCACCGG
GTGCTGCCGAAGACCCTGCACGTGGACGCGCCCACCCCGCATGTGGACTGGGAGTCCGGC
GCGGTGGAACTGCTCACCGAGGCCAAGCCGTGGGAGAGCGCCGACCATCCGCGGCGCGCC
GGGGTGTCCTCGTTCGGCATCAGCGGCACCAATGTGCACCTCATCCTGGAGGAAGCCCCC
GCCGCCGAGGCCGTCCCCCCGGCCGCCGAGGAGGCCCCGGCCCGGACCCCGGGCCTGGCC
GCGACCGGCACCGTGCCCTGGATCCTGTCCGGTGCGACCGCCGGGGCGCTGCGGGCACAG
GCTGCCCGGCTCCGGGCCTTCGTGGCGGACCGGCCGGAGCTGGACCCGGCCACCGTCGGA
TACTCCCTGGCCACCACCCGGGCCGCTCTGGAACACCGGGCGGTCGTGGTCGGCGCGGAC
CACACGGAGCTGCTCGGCGGGCTGACCGCCCTGGAACACGGTGAACCCGCCGGGAACCTG
GTGGAAGGTATCGCCGGCAGCCGGGGCAAGGTCGCCTTCCTCTTCCCCGGCCAGGGATCG
CAGTGGGCCGGCATGGCCGTGGAACTGCTCGACACCGCCCCGGTGTTCGCCGCCCGGATA
CGGGAGTGCGAGACCGCGCTGTCGGCGTTCACCGACTGGTCGCTGACCGACGTACTGCGG
GGCGCCAAGGGCGCACCGGGCTTCGACCGGGTGGATGTGGTGCAGCCCGCGCTGTGGGCG
GTGATGGTCTCACTGGCCGCGCTGTGGCAGTCCTGCGGTGTCACCCCCTCCGCCGTGGTC
GGGCACAGCCAGGGCGAGATCGCCGCCGCCTGTGTGGCCGGGGCGCTGTCCCTGGAGGAC
GCGGCCCGGGTGGTCGCCCTGCGCAGCAAGACCCTGATCGAACTGGCCGGCCACGGCGGC
ATGGTGTCCGTTCCGCTGCCGCTGGACCAGGTCGAGGAGCGGCTGCGGGCCTGGGGCGAG
CGGCTGTCCGTCGCCGCGGTCAACGGGCCGGCCTCGGTGGTCGTCTCCGGTGAACCGCAG
GCCCTGCAGGAGCTGTTGGACGGCTGCGAGGCCGACGGGGTGCGCGCCCGCCGGATCGAG
GTGGACTACGCCTCGCACTCGGCCCAGGTGGAGCAGATCCGGGAACGGCTGCTGGAGGTG
CTCGCACCGGTCCGCCCGCGGGCCGCCGACATCCCGGTGTACTCCACGCTCACCGGGGAC
TGGCTGGACACCACGACCATGGACGCGGACTACTGGTACCGCAGTCTGCGGCAGACCGTG
CTGTTCGAGCCTGCCGTCCGCGGTCTGCTCGACGCCGGCTACGGCACCCTGATCGAGGTC
AGCGCACACCCCGTGCTCGCGCTCGGCGTGCAGGACACCATCGAGGCGGCCGGCGGATCC
GCGCTGGTCACCGGTTCGCTGCGGCGCGACGAGGGTGGCGTGGCCCGGTTCCTCACCTCG
CTCGGCCAGGTGCATGCCCACGGGCAGAGCCCGGACTGGGCCGCCGTGTTCGCCGGGGCC
GCGCACGGGACGGTCGCCTTGCCGACGTACGCCTTCGAGCGGCAGCGGTACTGGCCGAAG
GGCACGCTGACCGCGGCCGGTGACGCCGCCGGCTTCGGGCTGAGCGCCGCCCGCCACCCG
CTGCTCGGCGCCGTGGTGACCCTGGCCGATGACGAAGGTGTGCTGTTCACCGGGCGGCTG
TCGCTGTCCACCCACGCCTGGCTGGCCGACCATGTGGTCGCCGGGCGGCCGGTCCTGCCC
GGCACCGCGTTCGTGGAACTGGCCGTACGCGCCGGAGACGAGGTCGGCTGCGAGGTCCTG
GAGGAACTCACCCTCGCGGCCCCGCTGGTACTGCCCGACCGGGGCGGCATCCGGCTCCAG
CTCGCCGTCGGCGGGCCCGACGCCGCCGGCCGCCGTGAGCTGAGTGTGCGCTCCCGGCCG
GAGGACGCACCCGACGAGGAGCCCTGGACCACCCACGCCACCGGCACCCTCGCCACCGGT
GCGGGCGCCGTCGGCCCGCGCGCGGAGTCCTGGCCGCCCGAGGGGGCCGAACCCGTCGAG
TGCGACGGCCTCTACGAACGGTTCGAGGGCACCGGACTGTCCTACGGCCCGGTGTTCCAG
GGCCTGCGCGCGGTGTGGCGGCGCGGCGGCGAACTGTTCGCCGAGGTCGCGCTGCCCGAG
GCGGCCGAGGACGAGGGCGCCGCGTTCGGACTGCATCCCGCGCTGCTGGACGCGGCCCTG
CACCCGCTCGCCCTCGGCGGGTTCGTCGAGGACGGGAGCGGGGACCGGCCGTGGCTGCCG
TTCGCCTGGTCCGGGGTGCGCCTGCACGCCGCGGGCGCCGGCACCGTGCGGGTGCGGCTG
TCCCCGACGGGCCCGAACGCGCTCTCGGTGACCGTCGCGGACGCCACCGGAGCCCCGGTC
GCCTCGGTGGCCTCCCTGATGCTGCGTCAGCTGACCTCCGAGACTCTCGACGGAACCGGC
CCCACCTTCCACGACGCGCTCTTCCGGGTCGACTGGACCCCGGCGCCGGTCCCGGCGGAG
GTCCCCGCCGGCACGGTCGCCCTGCTCGGCGCGGCCGGGCCGGACCACCGCGCGGCACTC
GAAGCGGCCGGCTCCCGGGTCGACGAGTACCCGGAACTGGCCGCGCTGCTCCGTGCCATG
GACGCCGGTGCGCCGGTGCCCGACGCCGTGCTCGTCTCCTGCGTTCCGCCGGAGGCGCCC
GAGGTCACCGCGGCGGTCAGGGAGGCGACCGGCCGTCTGCTCCAACTCGCCCAGGACTGG
CTGGCCGAGGAGCGGTTCGCCGACACCCGGCTGGTGATCGCCACCCAGGGCGCGGTGGCG
ACCGAGCCCGGGGCGGACCTGACGGATCTGGTGCACGCCCCGGTCTGGGGCCTGCTGCGC
ACCGCCCAGTCCGAACACCCAGGCCGGTTCGTCCTCCTGGACACCGACGGGCTGGAGACC
TCTGCCCGCGTCCTGCCCGCCGCACTGGCCCTCGGCGCGGACCAGCTCGCCCTGCGATCC
GGTGAGATCCGGCTGCCGCGACTGGCAAGGATGGCCGTATCCGCCGCCCCCGCACCCGAG
TTCACCCCCGGCGGCACCGTCCTGATCACCGGCGGCACCGGAACCCTGGGCGCGCTGTTC
GCCCGTCATCTGGTGACCGAGCACGGCGTCCGGCACCTCCTGCTGACCAGCCGCAGTGGC
CACACCGCCAAGGGTGCGGCCGCGCTGACGGCCGAACTGCGGGAACTCGGCGCCGAGGTG
GAGATCGCCGCCTGTGACGCGGCCGACCGTACGGCGCTGCGCGAACTGCTCGCCGCCATC
CCCGCCGACCGCCCGCTGACCGGCGTGATCAGCGCCGCCGGCACCCTGGACGACGGGGTG
CTGGAGTCGCTGAACCAGGAGCGCCTGGACGCCGTGATGCGGCCCAAGGTGGACGCCGCC
TGGCATCTGCACGAGCTGACCCGGGACCTCGACCTGGCGGCCTTCGTGGTGTTCTCCTCC
GCCGCCGGTGTCCTCGGCGGCTCCGGGCAGGCGAACTACGCCGCCGCCAACGCCTTCGTC
GACGCCCTCGCCGCACACCGGCGGGCCGCCGGGCTTCCCGCGCTCTCCCTGGCCTGGGGC
CGCTGGACGGAGACGAGCGGACTGACCGAGGCACTGGACGAGGCCGCGCTCGCCCGGATG
TCCCGCTCCGGCATGACCGGACTGTCCACGGAGCAGGGCGTCGCGCTGTTCGACGCGGCG
CGCGCCGCGGGGGACGCGCTGCTGGTCCCCGCGCGGCTCGACCTGGCCGCACTGCGGCAG
CAGGCCGGTTCCGGGATGGTGCCCGAGCTGCTGCGCGGCCTGGTCCGGACGCCCGGCCGA
CGGCAGGTGGACGGCGGCGCCGCCGCCACCTCCGAACTGCGCGAGCGTCTGACCGGGATG
TCCGCGGCGGAACGGGACCGCACCCTGCTCGATCTGGTCCGCGCCCAGGTCGCGGCCGTG
CTCGGCTACGCCGGTCCCCAAGCCGTGGAATCCACCCGGCCGTTCAAGGAGATCGGCTTT
GACTCGCTGACCGCGGTCGAGCTCCGCAACCGGCTCGGCGCGGCGGTCGGCCTCCGGCTG
CCCGCGACCCTGGTGTTCGACTATCCGACCCCGCTGGAGCTCGCCGGGTTCGTCCGGGAC
GAACTGCTGGGCGCGGCCGCCGGCACCGCGACCGGTGCACCGGCCGCCGTCCGCGCCGAT
GAGCCGATCGCGATCATCGGGATGAGCTGTCGCTACCCCGGTGGCGTCGATTCACCGGAG
AAGCTGTGGCAGCTGCTGACCAGCGGCACGGACGCGGTGTCCGCCTTCCCCGCGGACCGG
GGCTGGGACATGGAGCGCCTCTTCGACCCGGACCCGGACCACCCGGGCACCAGTTACTGC
ACCGAGGGAGGATTCCTCTACGACGCGGCGCGGTTCGACGCCGGCTTCTTCGGGATCAGC
CCGAAGGAGGCCCTGGCGATGGACCCGCAGCAGCGGCTGCTGCTGGAGACCTCCTGGGAG
ACCTTCGAACGCGCCGGGATCGACCCGGCGACGCTGAAGGGCAGTGGCACCGGGGTGTTC
GCCGGGGTGATGTACAACGACTACGGCATGCTGACCGCCGCGTCCGAACAGCTCGACGGC
TATGTGGGCGTCGGCGTCGCGGGTGGCGCCGTCTCCGGCCGGATCTCCTACACCTTCGGC
CTGGAGGGCCCCGCGGTCACCGTGGACACGGCCTGTTCGTCCTCGCTGGTCGCCCTGCAT
CTCGCGGTACAGGCCCTGCGGCAGGGGGAGTGCTCCCTCGCCCTGGCCGGCGGGGTGTCG
GTGATGGCGACTCCGGGCACCTTCATCGACTTCTCCCGGCAGCGCGGGCTCGCCCCGGAC
GGCCGGTGCAAGTCCTTCGCGGACGCGGCCGACGGCGCCGGCTGGGCCGAGGGCGCGGGC
GTCCTGCTCGTCGAGCGGCTGTCCGACGCGGTGCGCAACGGGCACCCGGTCCTCGCCGTG
GTGCGGGGGTCGGCGGTCAACCAGGACGGCGCCTCCAACGGGATGACCGCGCCGAACGGC
CCGTCCCAGCAGCGGCTGATCCGCCAGGCCCTGGCCAACGCCCGGCTGAACGCCGACCAG
ATCGACGCGGTGGAGGCACACGGCACGGGCACCACCCTCGGTGACCCCATCGAGGCACAG
GCCCTGCTGGCGACGTACGGACAGGACCGGCCCGAGGACCACCCGATGTGGCTCGGCTCG
ATCAAGTCCAACATCGGGCACACCCAGGCCGCGGCCGGTGTGGCCGGGGTGATGAAGATG
GTCCTCGCCATGCAGCACGGCGTACTGCCCCGGACGCTGCATGTGGACCGGCCCTCCACC
CACGTGGACTGGGAGTCCGGCGCGGTGGAGCTGCTCACCGAGGCCCGCGAGTGGCCGGAG
ACCGGGCAGCCCAGGCGGGCCGCGGTCTCCTCGTTCGGGATCAGCGGCACCAACGCGCAT
CTGATCCTGGAACAGCCCTCGGCGGCCCGTACCCCGGCCGCCGCCGGCACCGGGCCGGCT
CCCGCGGTGCTGCCGTGGGTGCTCTCCGCGCACTCGGCCCAGGCCCTGCGGGCCCAGGCC
GGACGGCTGGCCGCCCTCGCCGAGGGCGACCCGGACCCGGTGGACGTGGGCTTCTCCCTG
GTGTCGACCCGGTCCGCGCTACGGCACCGCGCCGTGCTGGTCGGGGACCGCGCGGCACTG
CTCACCGGCGCCCGGGCGCTGGCCGCGGGGACGCACCCGGCGGGTGCGGTCTCCGGGGTC
GCCGGGGAGGGCCGGATCGGGATGCTCTTCACCGGTCAGGGTGCCCAGCGGCTCGGGATG
GGCCGGGAACTCCACGCGGCCCACCCGGTGTTCGCCCGGGCCTGGGACGAGGTGTGCGCG
GCATTCGACGCACTGCTGCCCCGGCCGTTGCGCGAGGTGGTGTGGGCCGGACCGGGTACC
CCCGAGGCGGCCCTGCTGGACCAGACGCAGTACGCCCAGGCCGCGCTGTTCGCCGTCGAG
GTCGCACTGTTCCGGCTGGTGGAATCCCTCGGCGTGGTCCCGGACGCCCTGCTGGGACAC
TCCATCGGTGAGGTCACCGCGGCCCATCTCGCGGGTGTCTGGTCGCTGGCGGACGCGGCG
AAGCTGGTCGCTGCCCGCGGCAGACTCATGCAGAGCCTGCCCGCCGGCGGCGTGATGATC
GCCGTACGGGCCCCTGAGGACGTGGTCCTTCCGCTGCTCTCCGGCCAGGTGAGCATCGCC
GCGGTGAACGGGCCGGAGGCCGTGGTGCTCTCCGGCGCCGAGGCCGCGGTGACCGAACTC
GCCGCGACCCTGGCGGACAAGGGGTACCGCACCAAACAGCTCCGGGTCAGCCATGCGTTC
CACTCGCCGCTGATGGGCCCCGTGCTGGACGAGTTCCGCACCGTCGCCGAAAGCCTGACC
TACGCCGAACCGGGCATCCCCGTGGTCTCCAACCTGACCGGCCGGCTCGCCGAGCCGGAC
CAGTTGCGCGACCCCGGTTACTGGGTCCGGCACGTCCGGGAAGCCGTGCGCTTCCACGAC
GGCATGCAGGCGCTGCACACCGAGGGGCTGGACACTTTCCTCGAACTCGGCCCCGGCGGC
GTACTCAGCGCCATGGGCCAGGAGAGCCTGCCCGGCGGGGAGTTCCTGCCCGCGCTGCGC
AAGGACCGGGCGGAGGACGAAGCGCTGCTCCAGGCCCTGGCCGGTGCCTATGTCCGCGGC
GCCACGGTGGACTGGCTCCCGCTGTGCGGCGGTGGCCGCCGGGTCGCCCTCCCCACCTAC
GCCTTCCAGCGGCAGCGGTACTGGCCCGAGGCCGACGGCCCGTCCGGTGAAGGCCGGCCG
GACGCATCGGACCCGGTCGAGTCCCGCTTCTGGGAGCTGGTGGAACGGGAGGACCTCGGC
GCACTGCTGCGCACCCTGGACCTCGACGAGAACCAGCCGATCGGCGCGCTGCTGCCGGCC
CTGTCCGCCCTCCGCCGCGGCGAGTCCGCGGTGGACGGCACGCGCTACCGGGCCGACTGG
CACGCGGTGAGCGAACTGCCCACCGCCGAACTGTCCGGCACCTGGGCGCTGCTCGTCCCG
GAGCAGCACCTGGAGGGCGACTGCGCACGGTCGGTCGCCGAGGCGCTGCGGGCGCACGGC
GCCGAGGTGCGACAGCTCACCGTGACCGGTGCGGACGCCGGCCGGGAACGGCTGACCGGG
CTGCTCGCCGGACTCCCGGCGGGCATCGCCGGGGTGGTCTCCCTGTGGGCGCTGGACGAG
CAGCCGCATCCGGAGCACCCCTCGGTACCGTCCGGCGTGGCCGGAACCATGGCACTGAGC
CAGGCGCTCGACGAGGCGGCGCCGGGAGCACCGCTGTGGTCCCTGACCCGGGGCGCGGTC
TCGCTGACCCGTACGGGCCGTACGGCCGGGACGGCAGCGGCGCTGGTGTGGGGTCTCGGC
CGGGCGGTCGCCGCGGCCCGGCCCGGACACCGGGGCGGCCTGATCGATCTCCCGGAGACC
TTGGACGCCCGCCAAGGAGCCTGGCTGGCCCAGCTGCTGGCCGATGCCGACGGCGAGGAC
GAGCTCGCCCTGCGCCCCTCCGGGGTGTTCGCCCGCCGGCTCGGCCACGCGGGCCGCGGC
GCCGCCCACCGGCCCTGGCGTCCCACGGGCACCGCGTTGCTCGCCGGTGAACTGGGCGCC
GCCGGGGCGCCGGTCGCCCGTTGGCTGGCCCGCAACGGCGCCGCGCATCTGCTGGTGCCG
CCGGCGCTCGCCGGGGAGTCCCTCGGCGTCCCGGTGACCGTCATCGACGAGGCACTGACG
GACCGCGAGGCGGTGGCCCGGCTGCTGGGCCGCGTCCCCGCGGAGCATCCGCTGAGCACC
GTCGTGCACGGCATCGGCAGCGCCGAGGACCAGCCGGTCGGCTCCGCCACCGTCGCGCAG
TTCGGCCAGGTGCTGGAGCGGGCCGTGCACGAGTCCGAGATGCTGCACGAACTCGCCCGC
GACGCCGCCGCGTTCGTGCTGCTCGCCCCGGCGGCGAGCACCTGGGGCGATCCGTCGCGG
GCCGCGGTCACCGCGGCGGGCGCGTACCGCGAGGAGCTGGTGCGCCGGCGCCGGGCCGAG
GGGCTCAGCGGAACCGTGCTCTGCTGGGACGGTGCGCTCTCCCCGGAGAGCGTGTTCGTC
CGGGCGGTCGAGTGCGGCGAGCAGTCCGTCACCGTCGCCGAGGCGGACTGGGCGGAACTC
GCCGTCACCCGGACCGGTTCGCTGCTGCGTGCTCTGCCCGAGGTGCGACGGCCCGCCCAG
GAGCCCGCGGCGGAGACCGGCGACGAGGTGGACCCGGAGGCACTGCGGGCCTATCTGAAG
GAGCTGGACGCGGCGGGCCGGCAGGAGACCCTGCTGGAAATCGCCCGCGGCGTGGCGGCC
CGGGCACTGGGACATGAAAGCGCCGCGGCGGTCGAACCGGACCTCGATTTCCTCGATGCC
GGCTTCAATTCGCTGTCCGCGGTCGAATTCCGTAATGCACTGAACCGCATCACCGGACTG
TCGCTGCCCGCTGCGCTTGTCTACGATTATCCGACCCCCAACGCGGTCGTCGAGTTCCTG
GAATCCGAACTCGCCTGA
[16] KS34..409
[16] AT573..889
[16] methylmalonyl-CoA763..767
[16] DH939..1102
[16] KR1425..1605
[16] ACP1709..1779
[17] KS1800..2176
[17] AT2329..2642
[17] malonyl-CoA2518..2522
[17] kr2950..3112
[17] ACP3191..3261
[16] KS100..1227
[16] AT1717..2667
[16] methylmalonyl-CoA2287..2301
[16] DH2815..3306
[16] KR4273..4815
[16] ACP5125..5337
[17] KS5398..6528
[17] AT6985..7926
[17] malonyl-CoA7552..7566
[17] kr8848..9336
[17] ACP9571..9783

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [762-880]  1e-71 G3DSA:3.40.366.10 [2518-2632]  1.6e-73 G3DSA:3.40.366.10
G3DSA:3.40.366.10   no description
IPR006162 Phosphopantetheine attachment site (PTM)
 [1737-1752]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1702-1817]  2.5e-28 SSF47336 [3182-3264]  3.2e-18 SSF47336
SSF47336   ACP-like
 [1709-1779]  20.526 PS50075 [3191-3261]  17.675 PS50075
PS50075   ACP_DOMAIN
 [1712-1778]  1.3e-10 PF00550 [3197-3260]  7.7e-10 PF00550
PF00550   PP-binding
 [1708-1782]  3.7e-20 G3DSA:1.10.1200.10 [3189-3264]  2.2e-16 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   no description
IPR013968 Polyketide synthase, KR (Domain)
 [1425-1604]  3e-64 PF08659 [2950-3110]  3.9e-22 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [34-283]  2.7e-95 PF00109 [1800-2050]  2.5e-98 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [291-409]  2.8e-47 PF02801 [2058-2176]  5.2e-49 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [573-889]  4.1e-112 PF00698 [2329-2642]  5.8e-58 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [1-27]  3.2e-14 PF08990
PF08990   Docking
 [4-34]  5.3e-06 SSF101173
SSF101173   Docking domain B of the erythromycin polyketide synthase (DEBS)
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [570-872]  1.4e-66 SSF52151 [2325-2612]  2e-69 SSF52151
SSF52151   FabD/lysophospholipase-like
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [697-762]  1.7e-19 SSF55048 [2455-2517]  4.6e-16 SSF55048
SSF55048   Probable ACP-binding domain of malonyl-CoA ACP transacylase
IPR016038 Thiolase-like, subgroup (Domain)
 [37-295]  4.2e-89 G3DSA:3.40.47.10 [296-461]  2e-64 G3DSA:3.40.47.10 [1800-2061]  4.6e-89 G3DSA:3.40.47.10 [2062-2226]  4.9e-65 G3DSA:3.40.47.10
G3DSA:3.40.47.10   no description
IPR016039 Thiolase-like (Domain)
 [26-407]  2.5e-99 SSF53901 [1793-2174]  3e-102 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1424-1612]  7.8e-36 G3DSA:3.40.50.720 [2949-3109]  1.7e-06 G3DSA:3.40.50.720
G3DSA:3.40.50.720   no description
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [196-212]  PS00606 [1963-1979]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [574-871]  2.2e-121 SM00827 [2329-2623]  2.3e-119 SM00827
SM00827   Acyl transferase domain in polyketide syntha
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1710-1782]  2.3e-34 SM00823 [3192-3264]  2e-24 SM00823
SM00823   Phosphopantetheine attachment site
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [939-1102]  1.7e-85 SM00826
SM00826   no description
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [36-461]  4.1e-221 SM00825 [1803-2228]  6.7e-226 SM00825
SM00825   Beta-ketoacyl synthase
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1425-1605]  1.1e-60 SM00822 [2950-3112]  1.2e-07 SM00822
SM00822   no description
SignalP No significant hit
TMHMM No significant hit