close all open/close all

CDS information : Lydi_00180


close this sectionLocation

Organism
StrainTP-A0598 (=NBRC 110027)
Entry nameLydicamycin
Contig
Start / Stop / Direction99,364 / 102,459 / + [in whole cluster]
99,364 / 102,459 / + [in contig]
Location99364..102459 [in whole cluster]
99364..102459 [in contig]
TypeCDS
Length3,096 bp (1,031 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.2 NRPS
Productnon-ribosomal peptide synthetase
Product (GenBank)non-ribosomal peptide synthetase
GeneTPA0598_03_00820
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[26380643] Draft genome sequence of marine-derived Streptomyces sp. TP-A0598, a producer of anti-MRSA antibiotic lydicamycins. (Stand Genomic Sci. , 2015)

close this sectionPKS/NRPS Module

18 glycine
C16..293
A479..867
PCP955..1022

close this sectionSequence

selected fasta
>non-ribosomal peptide synthetase [non-ribosomal peptide synthetase]
MQPMSTPLSRASQKEEALWLLDKLVPDSGVNNIPAAIQVAGRLRTTALREAAARLLRKHE
VLRTVFHDEGAGLRKAILAPQDAPIDIEVSRSTADGLADDLTALAARPFKFNGRPMLRIC
QVEAPEGDVLCVVAHHLVFDVASAQIVMGELTRLYDAVLAGEDLSGEAIVPVAAVAADEP
RPESFQFWRDHLSGFDAGALDLWMDRQGSAETTLKGATVAHDLSDEARDVVRRLRRELRA
SEPVILLAAYYLLLAQHGAGPDIVIGSPADIRGQQAAGAIGYYVNILALRVRTDPAQSFR
ALVRQARDVFLEAVSHVDVHVDLLLPEIPRVNSAWSTTLFRHMFNYLPGGLSAETTIGGL
PARALMVRNGYSRMNLEFDILSEPDRITVEALYGVESHRRADVALLLQRYDALLVAAGAE
PDRPVGELSSWSEQDRTVIAAANRTATDAPTPSVLRTVAERAAAAPDAVAVVHGDRNVTY
AELWQAATDTRALLTASGVSEGDVVAVAARRGPELAAAALGVWLAGGAYLPVDPDHPADR
IAYQLSDSGARAVLAGDTVTLPDGTPRLDMAGLRTAEGGTTGLPAAPDPASCAYLIYTSG
STGRPKGTKVSHGNLANLVRHFLDELAPGPGDTTLWMTTFAFDISALELFLPLTSGGRLA
VAPDEARVNGSVLRDLLVRHDVGIVQATPTTWRTVLDQVGDHLAGRRVLCGGEALPADLA
ARLLETAGEVRNVYGPTETTIWSTAGRLDAGDGAVHAGTPLRNTTAFVRDPAGRELPLGV
HGELCLAGAGVAIGYHNRPELTAERFGEHPEYGRFYRTGDLARWRDNGTLEVLGRVDRQI
KLRGNRLELAEIEAVLREHPEVTDAAVVTVGDLSADAVLVAFVVAHPTEGLAERLWEHAR
AKLPSSAVPHDFVLTDELPTNANEKVDYPHLTRLATARRAAAGHGAAAEHHEDALVDALL
SLFRELLGREDVTADANFFVLGGHSLLAALLVQRIQESFGAEIRLAEFFALPTPLGLAAF
LRSRGVDPGTD
selected fasta
>non-ribosomal peptide synthetase [non-ribosomal peptide synthetase]
ATGCAGCCCATGAGTACGCCCCTCTCCCGGGCCAGTCAGAAAGAGGAGGCGTTGTGGCTG
CTCGACAAGCTGGTCCCGGACAGCGGGGTGAACAACATCCCGGCCGCCATCCAGGTGGCG
GGCCGGCTGCGGACCACGGCACTGCGCGAGGCCGCCGCCCGGCTCCTGCGCAAGCACGAG
GTGCTGCGCACCGTCTTCCATGACGAGGGCGCCGGGCTGCGCAAGGCGATCCTGGCCCCG
CAGGACGCCCCGATCGACATCGAGGTGAGCCGGTCGACGGCGGACGGGCTGGCGGACGAT
CTCACCGCGCTCGCCGCCCGCCCGTTCAAGTTCAACGGCCGGCCCATGCTGCGGATCTGC
CAGGTCGAGGCGCCCGAGGGCGATGTGCTCTGCGTCGTGGCCCACCACCTGGTGTTCGAT
GTGGCGTCCGCGCAGATCGTGATGGGTGAGCTCACCCGGCTCTACGACGCGGTCCTCGCC
GGGGAGGACCTCTCCGGCGAGGCGATCGTGCCGGTCGCGGCGGTCGCCGCCGACGAACCC
CGGCCGGAGAGCTTCCAGTTCTGGCGCGACCATCTGAGCGGCTTCGACGCCGGCGCGCTG
GATCTGTGGATGGACCGGCAGGGGAGTGCGGAGACCACCCTGAAGGGGGCCACCGTCGCG
CACGACCTCTCCGACGAGGCCCGGGACGTCGTCCGCCGGCTGCGCAGGGAACTGCGGGCC
TCCGAACCCGTCATCCTGCTCGCCGCCTACTATCTGCTGCTCGCCCAGCACGGCGCCGGG
CCGGACATCGTGATCGGCTCGCCCGCCGACATCCGCGGGCAGCAGGCCGCCGGTGCCATC
GGCTACTACGTGAACATCCTGGCGCTGCGCGTCCGGACCGACCCGGCACAGAGCTTCCGC
GCGCTGGTGCGACAGGCCCGGGACGTGTTCCTGGAGGCGGTCTCCCATGTCGATGTGCAT
GTGGACCTGCTGCTGCCGGAGATCCCGCGGGTCAACTCCGCATGGAGCACCACGCTGTTC
CGGCATATGTTCAACTACCTGCCGGGCGGGCTGTCCGCGGAGACGACCATCGGCGGCCTC
CCGGCGCGGGCCCTGATGGTCCGCAACGGCTACAGCCGGATGAACCTCGAATTCGACATC
CTCTCGGAGCCGGACCGCATCACCGTCGAGGCGCTGTACGGGGTGGAGTCCCACCGCCGC
GCCGATGTCGCACTCCTTCTCCAGCGCTATGACGCACTGCTGGTCGCGGCCGGCGCCGAA
CCGGACCGGCCGGTCGGCGAACTGTCCTCGTGGTCGGAGCAGGACCGTACGGTCATCGCC
GCGGCCAACCGCACCGCCACCGACGCGCCGACCCCCTCCGTGCTGCGCACCGTCGCCGAA
CGGGCGGCCGCCGCCCCGGACGCGGTCGCCGTCGTGCACGGCGACCGGAACGTGACCTAC
GCCGAGCTGTGGCAGGCGGCCACGGACACCCGGGCGCTGCTGACCGCCTCCGGGGTGAGC
GAGGGCGATGTGGTCGCCGTGGCCGCCCGCCGCGGACCCGAACTCGCCGCCGCGGCCCTG
GGCGTCTGGCTGGCCGGCGGCGCCTACCTCCCGGTCGACCCCGACCACCCCGCGGACCGG
ATCGCCTACCAGCTCTCGGATTCCGGCGCCCGTGCCGTACTGGCCGGCGACACGGTCACC
CTGCCCGACGGCACCCCCCGCCTGGACATGGCCGGTCTCCGCACCGCGGAGGGCGGGACC
ACCGGCCTCCCGGCGGCCCCGGACCCCGCCTCCTGCGCGTATCTCATCTACACCTCCGGT
TCCACCGGCCGCCCCAAGGGCACCAAGGTCTCGCACGGCAACCTGGCCAACCTCGTCCGG
CACTTCCTCGACGAGCTCGCGCCCGGCCCCGGCGATACCACGCTCTGGATGACCACCTTC
GCCTTCGACATCTCCGCGCTGGAGCTGTTCCTCCCGCTGACCTCCGGCGGACGGCTGGCC
GTCGCCCCCGACGAGGCCCGGGTGAACGGCAGCGTGCTGAGGGACCTGCTGGTCCGGCAC
GACGTGGGCATCGTGCAGGCCACCCCCACCACCTGGCGGACCGTGCTCGATCAGGTGGGC
GACCACCTGGCCGGCCGGCGGGTGCTGTGCGGCGGCGAGGCGCTCCCCGCCGACCTGGCA
GCGCGACTGCTGGAGACCGCCGGTGAGGTCCGCAATGTCTACGGCCCCACCGAGACCACC
ATCTGGTCCACCGCGGGCCGGCTCGACGCCGGTGACGGGGCGGTGCACGCCGGCACCCCG
CTGCGGAACACCACCGCCTTCGTACGGGATCCGGCCGGCCGGGAACTCCCGCTCGGTGTG
CACGGCGAACTGTGCCTCGCGGGCGCCGGAGTCGCGATCGGCTACCACAACCGCCCGGAA
CTCACCGCCGAACGGTTCGGCGAGCACCCCGAGTACGGGCGCTTCTACCGCACCGGAGAC
CTGGCCCGCTGGCGGGACAACGGAACACTGGAGGTGCTCGGCCGGGTGGACCGACAGATC
AAACTCCGTGGCAACCGCCTGGAACTCGCCGAGATCGAGGCGGTGTTGCGGGAGCACCCC
GAGGTGACCGACGCCGCCGTGGTCACCGTCGGCGATCTCAGTGCGGACGCCGTGCTGGTG
GCCTTCGTGGTGGCCCACCCCACCGAGGGCCTCGCCGAGCGGCTGTGGGAACACGCCAGG
GCGAAGCTGCCCTCGTCCGCGGTGCCGCACGACTTCGTACTCACCGATGAACTCCCCACC
AACGCCAACGAGAAGGTGGACTACCCTCACCTCACCCGGCTGGCCACCGCCCGCCGCGCC
GCGGCCGGCCACGGTGCGGCGGCGGAACACCACGAGGACGCCCTGGTCGACGCGCTGCTC
TCGCTGTTCCGCGAGCTGCTCGGCCGGGAGGACGTCACCGCCGATGCGAACTTCTTCGTC
CTGGGCGGGCATTCACTGCTCGCCGCGCTGCTGGTGCAGCGGATCCAGGAGTCCTTCGGA
GCGGAGATCCGACTCGCCGAGTTCTTCGCACTGCCCACCCCCCTGGGGCTCGCCGCGTTC
CTGCGGTCCCGCGGGGTGGATCCCGGTACCGACTGA
[18] C16..293
[18] A479..867
[18] glycine643..742
[18] PCP955..1022
[18] C46..879
[18] A1435..2601
[18] glycine1927..2226
[18] PCP2863..3066

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [479-867]  3.4e-106 PF00501
PF00501   AMP-binding
IPR001242 Condensation domain (Domain)
 [16-293]  1.9e-32 PF00668
PF00668   Condensation
IPR009081 Acyl carrier protein-like (Domain)
 [948-1023]  7.4e-16 SSF47336
SSF47336   ACP-like
 [947-1024]  7.6e-18 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   no description
 [957-1021]  1.5e-13 PF00550
PF00550   PP-binding
 [955-1022]  18.975 PS50075
PS50075   ACP_DOMAIN
IPR010071 Amino acid adenylation domain (Domain)
 [479-867]  1e-111 TIGR01733
TIGR01733   AA-adenyl-dom: amino acid adenylation domain
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [956-1025]  0.0013 SM00823
SM00823   Phosphopantetheine attachment site
IPR020845 AMP-binding, conserved site (Conserved_site)
 [595-606]  PS00455
PS00455   AMP_BINDING
SignalP No significant hit
TMHMM No significant hit