close all open/close all

CDS information : Lydi_00190


close this sectionLocation

Organism
StrainTP-A0598 (=NBRC 110027)
Entry nameLydicamycin
Contig
Start / Stop / Direction102,515 / 103,417 / + [in whole cluster]
102,515 / 103,417 / + [in contig]
Location102515..103417 [in whole cluster]
102515..103417 [in contig]
TypeCDS
Length903 bp (300 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical protein
GeneTPA0598_03_00830
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[26380643] Draft genome sequence of marine-derived Streptomyces sp. TP-A0598, a producer of anti-MRSA antibiotic lydicamycins. (Stand Genomic Sci. , 2015)

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical protein]
MPAMIMNGHCKSFNGDGKRDLLVRHDTSGELLVFPHSGKFDGTRTFLDPVKIGEDFHWEK
HLIIRTIDIRGNGLASVLAGSEESVNTEHPHGVYLYENKGGLNGLNTLSEPIRMSGRRDD
GRIWESIGVADVSGDGKDDTFGRESELGHVDWFRNTGNVVENDTFDKTPQRLTVTEPTDF
PFGMADVTGTGRLDLLILRDNGDLCVYEFPPGPDGFLGDGAGQGTWYTVGNLGADWNPLE
DALAVTDIDLDGNPDLLVRQRDGVLVAYAHSGTFDRKKPMNTFHPPVAVLQDCAEYHTLT
selected fasta
>hypothetical protein [hypothetical protein]
ATGCCGGCGATGATCATGAACGGCCATTGCAAATCCTTCAACGGCGACGGAAAGCGGGAT
CTGCTGGTTCGCCACGACACCAGTGGTGAACTGCTGGTCTTCCCGCACAGCGGAAAGTTC
GACGGCACCCGCACCTTTCTCGACCCGGTCAAGATCGGTGAGGACTTCCACTGGGAGAAG
CACCTCATCATCCGGACCATCGACATCCGCGGCAACGGACTGGCCAGTGTGCTCGCCGGC
AGCGAGGAATCGGTCAACACCGAGCATCCGCACGGGGTCTACCTCTACGAGAACAAGGGC
GGGCTCAACGGCCTGAACACCCTGAGCGAGCCGATCCGGATGTCCGGCCGCCGCGACGAC
GGCCGGATCTGGGAGAGCATCGGCGTCGCCGACGTCAGCGGGGACGGCAAGGACGACACC
TTCGGCCGGGAGAGCGAACTCGGTCATGTGGACTGGTTCCGCAACACCGGCAACGTGGTG
GAGAACGACACCTTCGACAAGACGCCGCAGCGGCTGACCGTCACCGAGCCCACCGACTTC
CCCTTCGGGATGGCCGATGTGACCGGCACCGGCCGGCTCGATCTGCTGATCCTGCGCGAC
AACGGCGATCTGTGCGTCTACGAGTTCCCGCCCGGACCGGACGGCTTCCTCGGCGACGGA
GCCGGTCAGGGCACCTGGTACACCGTCGGCAACCTCGGCGCGGACTGGAACCCGCTGGAG
GACGCGCTCGCGGTGACCGATATCGACCTGGACGGCAACCCCGATCTGTTGGTCCGGCAG
CGGGACGGCGTCCTGGTGGCGTACGCGCACTCCGGCACGTTCGACCGGAAGAAGCCGATG
AACACCTTCCACCCCCCGGTCGCCGTCCTCCAGGACTGCGCGGAGTACCACACGCTCACC
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit