close all open/close all

CDS information : Lydi_00200


close this sectionLocation

Organism
StrainTP-A0598 (=NBRC 110027)
Entry nameLydicamycin
Contig
Start / Stop / Direction103,446 / 109,217 / + [in whole cluster]
103,446 / 109,217 / + [in contig]
Location103446..109217 [in whole cluster]
103446..109217 [in contig]
TypeCDS
Length5,772 bp (1,923 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)polyketide synthase
GeneTPA0598_03_00840
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[26380643] Draft genome sequence of marine-derived Streptomyces sp. TP-A0598, a producer of anti-MRSA antibiotic lydicamycins. (Stand Genomic Sci. , 2015)

close this sectionPKS/NRPS Module

0
1 malonyl-CoA
ACP23..100
KS129..501
AT656..976
DH1022..1186
KR1485..1665
ACP1769..1839

close this sectionSequence

selected fasta
>polyketide synthase [polyketide synthase]
MNALDENPSLIQKLHGLSRPEQDRALLDLVCHHALGALRRVRPDDAPRTLAPDRPFTDLG
FDSLTAADLHVRLVAATGLPLPVTVAFDHPTPVRLARQLRAGLLGADGGDGTETTSEPPR
QAAAADDADPIAIVGIGCRYPGGIGSPEQLWRLVAEGGEVITGLPEDRGWDPETLYDPDP
DAPGKTYVRRGGFLHDAADFDAEFFGIGPREAQAMDPQQRLVLETSWEALERAGIDPTAL
RGSRAGVFLGAEPQEYGPRLTRAGGLEGYLSTGNTTSVIAGRVAYALGLEGPTMTVDTAC
SGSLVALHLACQALRQGECSVALAGGVAVMAAPGTFLSFSRQRGLAPDGRCKAFSADADG
TGWSEGVGVLVVERLSDARRAGHPVLALVRGSAVNSDGASNGLTAPNGPSQQRVIRQALD
AAGLDPHQVDAVEAHGTGTKLGDPIEAQSLIAAYGTGRTEPLWLGSVKSNLGHTQAAAGA
AGIIKMIMAMRQELLPRTLHVTEPTPHVDWAQGKAALLTEARPWPRTDRPRRAGISSFGF
SGTNAHIILEQAPPAPAPPPATAHPPVLALPVSARTPDALRAQAARLKSFLDEHPGPALT
DVGRALGTTRAQLEHRAVLVAADREELTRDLDALAAGAPGPGVRQGQAGSGAVAVLFTGQ
GAQRLGMGRELYAAHPVFARAWDEICAELDVHLPGPLRAVVWAEPGSPEAALLDETVYAQ
SALFALETALFRLLESWGLRPDFLLGHSLGEVTAAYVAGVWSLPDAAALVAARGRLMQEL
PAGGAMVSVRATEEEVTAELGRFEGRVGLAAVNGPASVVLSGDEDAVTEIAATLAARGHK
TQRLRVSHAFHSPRMQPMLDSFRWVTRVMSYKPPKIPVVSNLTGRIATGEELCAPDYWVD
HVRGAVRFADGIRALADHGVRTFLEVGPDAVLSAMAPDCVPGEDRPVFLPTLRRDRAETR
EATGALAAAWAHGAEVDWAAFHGGSGHPVDLPTYAFQRRRFWLDAGDQEPDAAALGQADA
GHPLLGAVIESAQADTRSYTGRLSLRSHPWLADHAINGAVLLPGTAFVDLALHAGDHTGC
PVLAELTLESPLVLPESGAIRLQVEVAAPDEQGDRGVLVSSRAEDDPDEVPWTRHATGRL
TATAPDHDGPDLRVWPPAEAEPVDLGGLYDGMAQRGYDYGPEFQGLRAAWRRGAEVFAEA
ALPEGAAGTDFALSPALLDAALHALDLGEFVPRDGRPWVPFAWAGVTLRAVGAKALRVRL
SAAGDHAVALDLADSTGAPVASVRSLVSRPVAAEQTAAARKGVVAQSLFRPEWSTVATPG
TPAGDWALLGDGDGPLGRALRSAGVRMRCHTELSAMDVPDLLVVPCAPAEGAPPEAARHT
AHRVLTLLRSWLADDRFSGSRLALVTEGDDFAASVVWGLVRSAQAEHPDRITVLDVDSWP
ASGPAVAGALATMEPQLMLKDGQLRLPRLARVTPPDTGADWDPEGTVLITGGTGGLGALV
ARHLVSAHGVRHLLLVSRRGPDAPGAADLRTELTALGATVTVAACDVSDRAALAGLLAGI
PAAHPLRAVVHAAGVLDDGVLTSLTPQRFDDVFRPKAEAAWLLHELTADRELTGFVLFSS
TATLLDGAGQANYAAANLFLEALARHRRATGRPATALAWTLWDEADGMAGRLGEAGLRRA
ARSGFPPLAPAEGLALFDAALATAETTLVPLRIDQAVLRARPGGVPALLAGVVRAPSRPA
ADAQAPAPAAESLATRLAALSAEEQRRTLLGLVRGQVAEVLGYDRPDAVVSGRGFLELGL
DSLAAVELRNRLTAATGVTLSSTLVFDHPTPEAVAEHLAGRLIESEADRTASVFAGIRRL
EAELAAVAPDDEEYAGVAARLRGLLTTWTETHRPEERPEDSALGAATAEELFDILDSELE
AGR
selected fasta
>polyketide synthase [polyketide synthase]
ATGAATGCCCTCGACGAAAACCCCTCACTGATCCAGAAGTTGCACGGGCTGTCCCGGCCC
GAGCAGGACCGGGCGCTGCTGGATCTGGTGTGCCACCACGCCCTCGGCGCGCTGCGCCGC
GTCCGGCCGGACGACGCACCGCGGACCCTGGCCCCGGACCGCCCCTTCACCGACCTCGGA
TTCGACTCGCTCACCGCGGCCGATCTGCATGTCCGGCTGGTGGCGGCCACCGGACTGCCG
CTTCCGGTCACCGTGGCCTTCGACCATCCGACCCCGGTACGACTGGCCCGGCAACTGCGC
GCCGGACTGCTCGGTGCGGACGGCGGGGACGGCACGGAGACCACCTCCGAGCCCCCGCGG
CAGGCGGCTGCGGCCGACGACGCGGACCCGATCGCCATCGTCGGGATCGGCTGCCGCTAC
CCCGGCGGGATCGGTAGCCCGGAACAGCTGTGGCGGCTGGTCGCCGAGGGCGGCGAGGTC
ATCACCGGACTGCCCGAGGACCGCGGCTGGGATCCGGAGACCCTGTACGACCCGGACCCG
GACGCCCCGGGCAAGACGTACGTCCGCCGCGGCGGATTCCTCCACGACGCGGCTGACTTC
GACGCGGAGTTCTTCGGGATCGGCCCGCGTGAGGCGCAGGCGATGGACCCGCAGCAGCGG
CTCGTACTGGAAACCTCGTGGGAGGCGCTGGAGCGGGCCGGTATCGACCCGACCGCGCTG
CGCGGCAGCCGCGCCGGGGTGTTCCTCGGCGCCGAGCCACAGGAGTACGGGCCCCGGCTG
ACCCGGGCCGGCGGGCTGGAGGGCTATCTCTCCACCGGCAACACCACCAGCGTCATCGCC
GGCCGGGTCGCCTACGCCCTGGGCCTGGAAGGCCCCACGATGACGGTGGACACCGCCTGT
TCGGGTTCCCTGGTCGCGCTGCATCTGGCCTGCCAGGCACTGCGGCAGGGGGAGTGCTCG
GTGGCCCTGGCCGGCGGGGTGGCCGTCATGGCCGCGCCCGGCACCTTCCTGTCCTTCTCC
CGGCAGCGCGGCCTCGCCCCGGACGGCCGGTGCAAGGCATTCTCGGCCGACGCGGACGGC
ACCGGCTGGTCCGAGGGCGTCGGCGTCCTGGTCGTGGAGCGCCTCTCCGACGCCCGCCGC
GCCGGGCATCCCGTACTCGCCCTGGTCCGTGGCTCGGCGGTCAACTCCGACGGCGCCTCC
AACGGGCTCACGGCACCCAACGGCCCCTCCCAGCAGCGGGTGATCCGCCAGGCCCTGGAC
GCCGCCGGACTGGACCCGCACCAGGTCGACGCGGTGGAGGCGCACGGCACCGGCACCAAG
CTCGGCGACCCGATCGAGGCGCAGTCCCTGATCGCGGCCTATGGCACCGGACGAACCGAA
CCGCTGTGGCTGGGCTCGGTCAAATCCAACCTGGGCCACACCCAGGCCGCCGCCGGTGCC
GCCGGAATCATCAAAATGATCATGGCGATGCGGCAGGAACTGCTGCCCCGCACCCTGCAT
GTCACCGAGCCCACCCCGCATGTCGACTGGGCGCAGGGCAAGGCCGCACTGCTCACCGAG
GCACGCCCCTGGCCGCGCACCGACCGTCCGCGCCGGGCCGGTATCTCCTCGTTCGGCTTC
AGCGGCACCAACGCGCACATCATCCTGGAACAGGCCCCGCCCGCCCCCGCGCCGCCGCCC
GCCACCGCACACCCCCCGGTCCTCGCGCTGCCGGTCTCCGCGCGCACTCCCGACGCCCTG
CGGGCGCAGGCCGCCCGGCTGAAGTCCTTCCTCGACGAGCACCCCGGGCCGGCCCTCACC
GATGTCGGCCGCGCACTGGGCACCACCCGGGCACAGCTGGAACACCGCGCGGTACTGGTC
GCCGCCGACCGGGAGGAGCTCACCCGCGACCTCGACGCCCTGGCCGCGGGTGCGCCGGGG
CCGGGCGTCCGCCAAGGACAGGCAGGGTCCGGCGCGGTCGCCGTGCTGTTCACCGGCCAG
GGCGCCCAGCGGCTCGGGATGGGCCGCGAACTGTACGCCGCCCACCCGGTGTTCGCCCGC
GCCTGGGACGAGATCTGCGCCGAGCTGGACGTCCATCTGCCCGGCCCGCTGCGCGCCGTG
GTGTGGGCGGAACCGGGGAGTCCCGAGGCCGCCCTGCTGGACGAGACGGTGTACGCCCAG
TCGGCGCTGTTCGCCCTGGAGACCGCACTGTTCCGGCTGCTGGAGTCCTGGGGGCTGCGG
CCGGACTTCCTGCTGGGCCACTCCCTCGGCGAGGTCACCGCCGCGTATGTGGCGGGGGTC
TGGTCGCTGCCCGACGCGGCCGCCCTGGTCGCCGCCCGTGGCCGGCTGATGCAGGAACTC
CCGGCCGGTGGCGCGATGGTGTCCGTACGGGCCACCGAGGAGGAGGTCACCGCCGAACTC
GGCCGATTCGAGGGGCGGGTGGGCCTCGCCGCGGTCAACGGGCCGGCCTCGGTGGTGCTC
TCCGGGGACGAGGACGCCGTCACCGAGATCGCCGCCACCCTTGCCGCGCGCGGCCACAAG
ACCCAGCGGCTGCGGGTGAGCCATGCCTTCCACTCCCCGCGGATGCAGCCGATGCTGGAC
AGCTTCCGCTGGGTGACCCGGGTGATGTCCTACAAGCCGCCGAAGATTCCGGTGGTCTCC
AACCTCACCGGCCGGATCGCCACCGGCGAGGAACTGTGCGCACCGGACTACTGGGTGGAC
CATGTCCGCGGCGCCGTCCGGTTCGCCGACGGTATCCGCGCGCTGGCGGACCACGGGGTG
CGCACCTTCCTGGAAGTGGGGCCGGACGCGGTGCTGTCCGCGATGGCACCGGACTGTGTG
CCGGGCGAGGACCGGCCCGTGTTCCTGCCCACCCTCCGCCGCGACCGCGCGGAGACCCGA
GAGGCCACCGGTGCCCTGGCCGCTGCCTGGGCGCACGGCGCGGAGGTGGACTGGGCCGCG
TTCCACGGCGGTTCCGGCCACCCGGTGGACCTGCCCACCTATGCCTTCCAGCGGCGGCGG
TTCTGGCTGGACGCGGGGGACCAGGAGCCGGACGCGGCCGCGCTCGGCCAGGCCGACGCC
GGGCATCCGCTGCTCGGCGCGGTGATCGAGTCCGCGCAGGCGGACACCCGCTCGTACACC
GGCCGCCTCTCGCTGCGCTCCCACCCCTGGCTGGCCGACCACGCCATCAACGGCGCCGTC
CTCCTGCCGGGCACCGCCTTCGTCGACCTCGCACTGCACGCCGGTGACCACACGGGCTGC
CCCGTCCTGGCCGAACTGACCCTGGAAAGCCCGCTGGTGCTGCCGGAATCCGGTGCGATA
CGGCTCCAGGTCGAGGTGGCCGCACCGGACGAACAGGGCGACCGCGGGGTCCTGGTGTCC
TCCCGTGCCGAGGACGATCCGGACGAGGTGCCCTGGACCCGGCACGCCACCGGCCGGCTC
ACCGCCACCGCCCCGGACCACGACGGCCCCGACCTGCGCGTCTGGCCGCCGGCCGAGGCG
GAACCGGTCGATCTCGGCGGGCTCTACGACGGTATGGCGCAGCGCGGTTACGACTACGGG
CCGGAGTTCCAGGGCCTGCGCGCCGCCTGGCGCCGTGGCGCGGAGGTGTTCGCCGAGGCC
GCACTGCCCGAGGGGGCCGCCGGCACGGACTTCGCGCTGTCCCCGGCGCTCCTCGACGCG
GCCCTGCACGCCCTGGACCTGGGGGAGTTCGTCCCACGGGACGGACGGCCCTGGGTGCCG
TTCGCCTGGGCCGGGGTGACCCTGCGGGCCGTCGGCGCGAAGGCGCTGCGGGTGCGGCTG
TCCGCAGCGGGGGACCATGCGGTCGCCCTGGACCTCGCCGACTCCACGGGCGCCCCGGTC
GCCTCGGTGCGCTCCCTGGTCTCCCGGCCGGTGGCCGCCGAACAGACCGCGGCGGCCCGG
AAGGGCGTGGTGGCCCAGTCACTGTTCCGGCCGGAATGGAGCACCGTGGCCACCCCGGGC
ACACCGGCCGGCGACTGGGCGCTGCTGGGCGACGGCGACGGCCCCCTCGGCCGCGCGCTA
CGGTCCGCCGGGGTCCGGATGCGGTGTCACACCGAGCTGTCCGCCATGGACGTACCGGAC
CTCCTGGTGGTGCCCTGCGCCCCCGCCGAGGGCGCGCCGCCCGAGGCCGCCCGCCACACC
GCGCACCGCGTCCTCACGCTGCTGCGGTCCTGGCTCGCCGACGACCGGTTCTCCGGCTCC
CGGCTCGCCCTGGTGACCGAGGGCGACGACTTCGCGGCCTCGGTGGTCTGGGGCCTGGTG
CGCTCGGCGCAGGCCGAACACCCGGACCGGATCACCGTGCTCGACGTGGATTCCTGGCCG
GCCTCCGGCCCGGCCGTGGCCGGTGCACTGGCCACCATGGAGCCCCAACTGATGCTGAAG
GACGGCCAGTTGCGCTTGCCGCGGCTGGCGCGGGTCACCCCGCCGGACACCGGTGCGGAC
TGGGACCCGGAAGGCACCGTGCTGATCACCGGCGGCACCGGCGGGCTCGGCGCTCTCGTC
GCCCGGCACCTCGTCAGCGCGCACGGGGTGCGGCACCTGCTGTTGGTCAGCCGCCGGGGA
CCGGACGCACCGGGCGCGGCGGACCTGCGCACCGAGCTGACCGCGCTCGGCGCCACCGTG
ACCGTGGCCGCCTGCGATGTCTCCGACCGTGCGGCCCTGGCCGGGCTGCTCGCCGGGATC
CCCGCCGCGCATCCGCTGCGCGCCGTGGTGCACGCCGCCGGGGTGCTCGACGACGGAGTC
CTCACCTCGCTGACCCCGCAACGCTTCGACGACGTCTTCCGGCCCAAGGCGGAGGCGGCC
TGGCTGCTGCACGAACTGACCGCGGATCGGGAACTCACCGGGTTCGTCCTGTTCTCCTCC
ACCGCCACCTTGCTCGACGGGGCCGGCCAGGCGAACTACGCGGCCGCCAACCTGTTCCTC
GAAGCGCTCGCCCGGCACCGCCGAGCCACCGGCCGCCCGGCGACCGCGCTGGCCTGGACG
CTGTGGGACGAGGCCGACGGGATGGCCGGCCGGCTCGGCGAGGCCGGTCTGCGCCGAGCC
GCCCGGTCCGGTTTCCCGCCGCTCGCCCCGGCCGAAGGCCTGGCACTGTTCGACGCCGCG
CTCGCCACCGCGGAGACCACCCTGGTCCCGCTGCGCATCGACCAGGCCGTGCTGCGGGCC
CGTCCCGGCGGCGTCCCCGCGCTGCTGGCCGGGGTGGTCCGGGCACCGTCCCGGCCTGCC
GCCGACGCCCAGGCACCGGCTCCGGCCGCGGAATCCCTGGCCACCCGGCTGGCGGCGCTC
TCCGCCGAGGAGCAGCGGCGCACCCTGCTGGGCCTCGTCCGCGGGCAGGTCGCCGAGGTC
CTCGGCTACGACCGCCCGGACGCGGTGGTCAGCGGCCGGGGCTTCCTCGAACTCGGCCTG
GATTCGCTCGCCGCGGTCGAACTGCGCAACCGGCTGACCGCCGCCACCGGGGTGACCCTG
TCCTCCACGCTGGTCTTCGACCACCCCACGCCCGAGGCGGTCGCGGAGCACTTGGCCGGC
CGCCTCATCGAGAGCGAAGCGGACCGGACCGCCTCGGTGTTCGCCGGAATCCGCCGGCTG
GAAGCGGAGCTGGCGGCCGTGGCGCCGGACGACGAGGAGTACGCCGGTGTCGCGGCCCGG
CTGCGCGGACTGCTCACCACATGGACCGAAACGCATCGCCCCGAAGAGCGGCCGGAGGAC
TCCGCCCTGGGGGCCGCCACCGCCGAGGAACTCTTCGACATCCTCGACAGCGAACTGGAG
GCCGGCAGATAA
[0] ACP23..100
[1] KS129..501
[1] AT656..976
[1] malonyl-CoA848..852
[1] DH1022..1186
[1] KR1485..1665
[1] ACP1769..1839
[0] ACP67..300
[1] KS385..1503
[1] AT1966..2928
[1] malonyl-CoA2542..2556
[1] DH3064..3558
[1] KR4453..4995
[1] ACP5305..5517

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [848-962]  1.1e-75 G3DSA:3.40.366.10
G3DSA:3.40.366.10   no description
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [1485-1651]  5.6e-63 PF00106
PF00106   adh_short
IPR006162 Phosphopantetheine attachment site (PTM)
 [1797-1812]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [19-145]  2.5e-18 SSF47336 [1761-1856]  2.7e-22 SSF47336
SSF47336   ACP-like
 [45-98]  5.7e-09 PF00550 [1773-1838]  6.3e-12 PF00550
PF00550   PP-binding
 [23-100]  15.508 PS50075 [1769-1839]  20.389 PS50075
PS50075   ACP_DOMAIN
 [45-101]  6.6e-12 G3DSA:1.10.1200.10 [1767-1842]  6.2e-20 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   no description
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [129-378]  1.8e-98 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [386-501]  2.8e-46 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [656-976]  6.9e-62 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [652-948]  1.4e-68 SSF52151
SSF52151   FabD/lysophospholipase-like
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [782-847]  7e-18 SSF55048
SSF55048   Probable ACP-binding domain of malonyl-CoA ACP transacylase
IPR016038 Thiolase-like, subgroup (Domain)
 [131-390]  7.9e-88 G3DSA:3.40.47.10 [391-554]  1.2e-64 G3DSA:3.40.47.10
G3DSA:3.40.47.10   no description
IPR016039 Thiolase-like (Domain)
 [121-491]  1.7e-103 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1486-1670]  2.2e-33 G3DSA:3.40.50.720
G3DSA:3.40.50.720   no description
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [656-956]  1.4e-126 SM00827
SM00827   Acyl transferase domain in polyketide syntha
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [27-103]  7.3e-18 SM00823 [1770-1842]  1.1e-31 SM00823
SM00823   Phosphopantetheine attachment site
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [1022-1186]  2.5e-81 SM00826
SM00826   no description
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [131-554]  1.3e-217 SM00825
SM00825   Beta-ketoacyl synthase
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1485-1665]  6.3e-57 SM00822
SM00822   no description
SignalP No significant hit
TMHMM No significant hit