close all open/close all

CDS information : Lydi_00210


close this sectionLocation

Organism
StrainTP-A0598 (=NBRC 110027)
Entry nameLydicamycin
Contig
Start / Stop / Direction110,570 / 109,281 / - [in whole cluster]
110,570 / 109,281 / - [in contig]
Locationcomplement(109281..110570) [in whole cluster]
complement(109281..110570) [in contig]
TypeCDS
Length1,290 bp (429 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative cytochrome P450
Product (GenBank)cytochrome P450
GeneTPA0598_03_00850
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[26380643] Draft genome sequence of marine-derived Streptomyces sp. TP-A0598, a producer of anti-MRSA antibiotic lydicamycins. (Stand Genomic Sci. , 2015)
Related Reference
ACC
Q156A0
PmId
[16972046] Cloning and expression of a cytochrome P450 hydroxylase gene from Amycolatopsis orientalis: hydroxylation of epothilone B for the production of epothilone F. (J Ind Microbiol Biotechnol. , 2007)

close this sectionSequence

selected fasta
>putative cytochrome P450 [cytochrome P450]
MTEIDSNGSVRELNFPMSRRCPFAPPPEYERLRADSPLVRVQLPHGGTAWVVTRHAEAQQ
LLTDPRVSSDASRPGFPSVRPPQEPPADEGTDGAEPLTAEQLTELAEIAQFHEGQFINLD
PPRHGHYRRMLISEFGARRMNELRPEVQRITDRLVDDMLAKGSPADLVEDLGLPLSSLVI
CRLLGVPYEDHEYFQSATRTLVQLDAEPEQVKAAMEGLIDFLDELVKAAVRAPGDNLIGR
LINEQVGSGELTRAALVGMAFLLLTAGHEATANMLPLGMLTLLEHPQQLAELRENPALLP
GAVDELLRFHSVSDWAAFDRVAVEDIEIDGRKIMAGEGIFVLSASANRDERVFERPDTFD
IHRKARHHIAFGYGVHQCIGQNLARAELEIGLGTLLRRIPALRLDKPMDELPFKYQNFVF
GLHAMPVRW
selected fasta
>putative cytochrome P450 [cytochrome P450]
ATGACGGAGATTGACAGCAACGGGTCGGTGCGGGAATTGAACTTCCCCATGTCCCGGCGC
TGCCCCTTCGCCCCGCCACCGGAGTACGAAAGGCTGCGAGCGGACTCCCCGCTGGTGCGG
GTGCAGCTGCCGCACGGCGGTACCGCGTGGGTGGTGACCCGGCACGCGGAGGCCCAGCAG
CTGCTGACCGACCCACGGGTCAGCTCGGATGCGAGCCGGCCGGGCTTCCCCAGCGTCCGG
CCGCCCCAGGAGCCGCCGGCCGACGAGGGCACGGACGGGGCGGAACCGCTCACCGCCGAG
CAGCTCACCGAGCTGGCGGAGATCGCCCAGTTCCACGAGGGCCAGTTCATCAACCTGGAT
CCGCCCCGGCACGGTCACTACCGGCGCATGCTCATCTCCGAGTTCGGTGCGCGGCGGATG
AACGAGCTGCGGCCGGAGGTCCAGCGCATCACCGACCGGCTGGTCGACGACATGCTGGCG
AAGGGCTCCCCGGCGGACCTCGTGGAGGATCTGGGGCTGCCGCTCTCCTCGCTGGTCATC
TGCCGGTTACTCGGCGTCCCGTACGAGGATCACGAGTACTTCCAGTCCGCGACCAGGACA
CTGGTCCAGCTGGACGCCGAGCCCGAGCAGGTCAAGGCGGCGATGGAGGGGCTCATCGAC
TTCCTCGACGAGCTGGTCAAGGCGGCCGTGCGGGCACCCGGCGACAACCTCATCGGCCGG
CTGATCAACGAACAGGTCGGCAGCGGTGAGCTGACCCGTGCGGCGCTGGTGGGCATGGCC
TTCCTGCTGCTGACCGCCGGACACGAGGCGACCGCGAACATGCTTCCGCTGGGCATGCTG
ACCCTGCTGGAGCATCCGCAGCAGCTGGCCGAACTCCGCGAGAACCCCGCGCTGCTGCCC
GGCGCCGTCGATGAGCTGCTGCGGTTTCACTCCGTGTCGGACTGGGCGGCCTTTGACCGG
GTCGCCGTTGAGGACATCGAGATCGACGGCCGGAAAATCATGGCCGGTGAGGGCATTTTC
GTGCTGAGCGCGTCGGCCAACCGGGACGAGCGGGTCTTCGAGCGCCCCGATACGTTCGAC
ATCCACCGCAAGGCCCGGCACCACATCGCGTTCGGGTACGGGGTGCACCAGTGCATCGGG
CAGAATCTGGCCCGCGCCGAGTTGGAGATCGGTCTGGGCACGCTGCTGCGGCGGATTCCC
GCTCTGCGGCTCGACAAGCCGATGGATGAACTTCCGTTCAAATACCAGAACTTCGTGTTC
GGACTGCACGCGATGCCGGTCCGCTGGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [266-283]  2.5e-07 PR00385 [301-312]  2.5e-07 PR00385 [369-378]  2.5e-07 PR00385 [378-389]  2.5e-07 PR00385
PR00385   P450
 [16-429]  1.7e-105 G3DSA:1.10.630.10
G3DSA:1.10.630.10   no description
 [214-398]  3.4e-26 PF00067
PF00067   p450
 [11-429]  6.7e-95 SSF48264
SSF48264   Cytochrome P450
IPR002397 Cytochrome P450, B-class (Family)
 [119-130]  2e-52 PR00359 [166-182]  2e-52 PR00359 [183-198]  2e-52 PR00359 [220-242]  2e-52 PR00359 [301-312]  2e-52 PR00359 [320-347]  2e-52 PR00359 [348-363]  2e-52 PR00359 [369-378]  2e-52 PR00359 [378-389]  2e-52 PR00359
PR00359   BP450
IPR017972 Cytochrome P450, conserved site (Conserved_site)
 [371-380]  PS00086
PS00086   CYTOCHROME_P450
SignalP No significant hit
TMHMM No significant hit