close all open/close all

CDS information : Lydi_00220


close this sectionLocation

Organism
StrainTP-A0598 (=NBRC 110027)
Entry nameLydicamycin
Contig
Start / Stop / Direction111,257 / 112,039 / + [in whole cluster]
111,257 / 112,039 / + [in contig]
Location111257..112039 [in whole cluster]
111257..112039 [in contig]
TypeCDS
Length783 bp (260 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical protein
GeneTPA0598_03_00860
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[26380643] Draft genome sequence of marine-derived Streptomyces sp. TP-A0598, a producer of anti-MRSA antibiotic lydicamycins. (Stand Genomic Sci. , 2015)

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical protein]
MNHSAESHSSSVTDAPEKAAKDEPKKVPENFQDQLAYAWEYIGGVYGTILTILPVITYIV
VNALTSMWPAIWASIGTAVLVGIFQLLRKEKLAAAFVGLGTVLITSGVAVFVGEAKGYYL
LGNWITVGIGSILLLSVLVRRPLIGQVWSAANLQGTFWRKDRKSLFYYDVATLLWSFLSF
SRFAVERWLYNMDETTWLGIARLVMGWPLTFFAVMTSIWAVRKVDGRRKLHDPNYKDPKQ
QEESEESGPVDTETAKSRGE
selected fasta
>hypothetical protein [hypothetical protein]
GTGAACCACTCGGCCGAGTCGCATTCCTCGTCCGTGACCGACGCACCGGAAAAGGCTGCC
AAGGACGAGCCGAAGAAGGTCCCGGAGAATTTCCAGGACCAGCTGGCCTACGCCTGGGAG
TACATCGGCGGGGTCTACGGCACGATCCTGACCATCCTGCCGGTCATCACCTACATCGTG
GTCAACGCGCTGACCAGCATGTGGCCGGCGATCTGGGCCTCCATCGGCACCGCGGTCCTG
GTGGGAATCTTCCAGCTGCTGCGCAAGGAGAAGCTGGCCGCCGCGTTCGTCGGGCTCGGC
ACCGTCCTCATCACCTCCGGCGTCGCCGTGTTCGTCGGTGAGGCCAAGGGCTACTACCTG
CTGGGCAACTGGATCACCGTCGGTATCGGGAGCATTCTGCTGCTGTCCGTCCTGGTGCGC
CGGCCCCTGATCGGTCAGGTCTGGTCGGCGGCCAACCTCCAGGGCACGTTCTGGCGCAAG
GACCGCAAGTCGCTCTTCTACTACGACGTGGCGACGCTGCTCTGGTCGTTCCTGAGCTTC
TCCCGGTTCGCGGTGGAGCGGTGGCTCTACAACATGGACGAGACCACCTGGCTCGGCATC
GCGCGGCTCGTCATGGGCTGGCCGCTGACCTTCTTCGCCGTCATGACCAGTATTTGGGCG
GTCCGTAAGGTGGACGGGCGGCGTAAACTGCACGACCCGAATTACAAGGATCCCAAGCAG
CAGGAGGAATCCGAGGAGAGCGGCCCGGTGGATACGGAGACCGCAAAAAGCCGCGGAGAA
TAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR016566 Uncharacterised conserved protein UCP010219 (Family)
 [42-225]  2.4e-48 PF11361
PF11361   DUF3159
SignalP No significant hit
TMHMM
 [42-64]  Transmembrane (i-o) [68-87]  Transmembrane (o-i) [94-113]  Transmembrane (i-o) [117-139]  Transmembrane (o-i) [165-184]  Transmembrane (i-o) [199-221]  Transmembrane (o-i)
Transmembrane 6