close all open/close all

CDS information : Lydi_00230


close this sectionLocation

Organism
StrainTP-A0598 (=NBRC 110027)
Entry nameLydicamycin
Contig
Start / Stop / Direction112,302 / 113,063 / + [in whole cluster]
112,302 / 113,063 / + [in contig]
Location112302..113063 [in whole cluster]
112302..113063 [in contig]
TypeCDS
Length762 bp (253 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productputative type II thioesterase
Product (GenBank)type-II thioesterase
GeneTPA0598_03_00870
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[26380643] Draft genome sequence of marine-derived Streptomyces sp. TP-A0598, a producer of anti-MRSA antibiotic lydicamycins. (Stand Genomic Sci. , 2015)
Related Reference
ACC
Q846W2
NITE
Monen_00290
PmId
[16984884] Identification of NanE as the thioesterase for polyether chain release in nanchangmycin biosynthesis. (Chem Biol. , 2006)
ACC
Q7BUF9
NITE
Rifam_00540
PmId
[19103602] Structure and functional analysis of RifR, the type II thioesterase from the rifamycin biosynthetic pathway. (J Biol Chem. , 2009)
ACC
Q9ZGI1
NITE
Pikro_00070
PmId
[9770448] A gene cluster for macrolide antibiotic biosynthesis in Streptomyces venezuelae: architecture of metabolic diversity. (Proc Natl Acad Sci U S A. , 1998)
[10421766] Elucidating the mechanism of chain termination switching in the picromycin/methymycin polyketide synthase. (Chem Biol. , 1999)
[10676969] Alternative modular polyketide synthase expression controls macrolactone structure. (Nature. , 2000)
[10713461] Genetic architecture of the polyketide synthases for methymycin and pikromycin series macrolides. (Gene. , 2000)
[11223265] The Streptomyces venezuelae pikAV gene contains a transcription unit essential for expression of enzymes involved in glycosylation of narbonolide and 10-deoxymethynolide. (Gene. , 2001)
[12368286] Biochemical evidence for an editing role of thioesterase II in the biosynthesis of the polyketide pikromycin. (J Biol Chem. , 2002)
ACC
Q6W5Q5
NITE
FR008_00110
PmId
[18836004] Selective removal of aberrant extender units by a type II thioesterase for efficient FR-008/candicidin biosynthesis in Streptomyces sp. strain FR-008. (Appl Environ Microbiol. , 2008)

close this sectionSequence

selected fasta
>putative type II thioesterase [type-II thioesterase]
MNAHADEDLWIRRFHPAPEAATRLVCLPHAGGSASFYFPVSRALAPAIDVLAVQYPGRQD
RRTEPCLDDIADLADEVTERLLPWTDRPLAIFGHSMGATLAFEVALRLEQREITLQALFA
SGRRAPSRHREETAHLYDDAALVREIKALNGTESQTLDDEEMLRAVLPALRSDYRAAETY
RYQPGPPLNCPVYAMIGESDPKVSIDEARSWVDHTMGRFELQTYPGGHFYLNAQAPRIIA
AISQAVSATSGTV
selected fasta
>putative type II thioesterase [type-II thioesterase]
GTGAACGCGCACGCCGATGAGGATCTGTGGATCCGACGGTTCCATCCCGCGCCGGAGGCG
GCGACCAGGCTGGTCTGCCTGCCCCACGCCGGCGGCTCGGCCAGTTTCTATTTCCCGGTG
TCCAGGGCGCTCGCCCCGGCGATCGATGTGCTGGCGGTGCAGTACCCCGGCCGTCAGGAC
CGCCGGACCGAGCCCTGCCTGGACGACATCGCGGACCTCGCCGACGAGGTGACCGAGCGG
CTGCTGCCCTGGACCGACCGGCCGCTGGCGATCTTCGGACACAGCATGGGCGCCACCCTC
GCCTTCGAGGTGGCGCTCCGTCTCGAACAGCGCGAGATCACCCTCCAGGCCCTGTTCGCC
TCCGGCCGCCGGGCACCGTCCCGGCACCGCGAGGAGACGGCGCACCTGTACGACGACGCC
GCCCTGGTCCGCGAGATCAAGGCGCTCAACGGCACCGAGTCCCAGACACTGGACGACGAG
GAGATGCTCCGCGCGGTGCTGCCCGCGCTCCGCAGCGACTACCGGGCCGCGGAGACCTAC
CGCTATCAGCCGGGGCCGCCGCTCAACTGCCCCGTCTACGCCATGATCGGGGAAAGCGAC
CCGAAGGTGAGCATCGACGAGGCCCGTTCCTGGGTCGACCACACCATGGGCCGCTTCGAG
TTGCAGACCTACCCCGGCGGGCACTTCTACCTGAACGCCCAAGCGCCCCGCATCATCGCC
GCCATCTCCCAAGCGGTGTCGGCGACTTCCGGAACCGTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001031 Thioesterase (Domain)
 [23-245]  2.2e-55 PF00975
PF00975   Thioesterase
SignalP No significant hit
TMHMM No significant hit