close all open/close all

CDS information : Lydi_00240


close this sectionLocation

Organism
StrainTP-A0598 (=NBRC 110027)
Entry nameLydicamycin
Contig
Start / Stop / Direction114,791 / 113,136 / - [in whole cluster]
114,791 / 113,136 / - [in contig]
Locationcomplement(113136..114791) [in whole cluster]
complement(113136..114791) [in contig]
TypeCDS
Length1,656 bp (551 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
Productputative oxidoreductase
Product (GenBank)putative amine oxidase
GeneTPA0598_03_00880
Gene (GenBank)
EC number
Keyword
Note
  • The N-terminal position was modified from original publication.
Note (GenBank)
Reference
ACC
PmId
[26380643] Draft genome sequence of marine-derived Streptomyces sp. TP-A0598, a producer of anti-MRSA antibiotic lydicamycins. (Stand Genomic Sci. , 2015)
Related Reference
ACC
Q52V64
PmId
[15844935] Microbial genomics as a guide to drug discovery and structural elucidation: ECO-02301, a novel antifungal agent, as an example. (J Nat Prod. , 2005)
Family/Domain
FD
IPR002937

close this sectionSequence

selected fasta
>putative oxidoreductase [putative amine oxidase]
MTLASSERVTMFVPDFPFAYDDWLRHPAGLGAVPRHRHGTPVAVIGGGMSGMTAAYELMR
LGLRPVVYEAEQLGGRMRSVPFPEYPALRAEMGAMRFPLSATTLFHYIDALGLRTSPFPN
PLAACTPATLVNLEGRTHRARSAADLPSEFQEVADAWAKALQDRAELSSLQDAIRRRDIP
VLKAIWNQLVKEYDDQSFYGFLATSPAFASFRHREIFGQVGFGTGGWDTDFPNSIIEILR
VVCTAADDDQMTIEGGAQQVPRGLWTLRPDRLAHWPAGTSLAGLHGGAPRTAAVGIRRDA
EGYTVTDADGRRDRYPAVVFSPHVWALLNHVDSDPELLPADLWSAVERTHYMGSSKVFVL
TDRPFWLDTDPDTGRMAIGMTLTDRMPRSVYLFDSGPDRPGVMCLSYTWNDDSLKFATLS
AEQRLELLLTKLGEIYPGVDIRSHLISAPLTITWETEPRFMGAFKANLPGHYRYQRRLFS
HFMQHELDPRHRGFFLCGDDISWTGGFAEGAVTTALNAVWGVVNHLGGSTAPENPGPGDV
FHEIAPVRLPE
selected fasta
>putative oxidoreductase [putative amine oxidase]
ATGACCTTGGCCAGTTCGGAACGAGTGACCATGTTCGTGCCGGATTTCCCTTTCGCCTAT
GACGACTGGCTGCGACATCCGGCCGGGCTCGGCGCCGTACCCCGGCATCGGCACGGCACT
CCGGTGGCGGTGATCGGCGGCGGGATGTCCGGGATGACCGCGGCCTATGAGCTGATGCGG
CTCGGGCTGCGGCCGGTGGTGTACGAAGCCGAGCAGCTCGGCGGGCGGATGCGTTCGGTG
CCGTTCCCGGAATATCCCGCGTTACGGGCCGAGATGGGCGCGATGCGCTTTCCGCTGTCG
GCGACCACGCTGTTCCATTACATCGACGCGCTCGGGCTGCGTACCTCGCCGTTCCCCAAT
CCCCTGGCGGCCTGCACTCCCGCCACTCTGGTGAATCTGGAGGGACGCACACACCGGGCG
CGGTCGGCGGCCGATCTGCCCTCGGAGTTCCAGGAAGTCGCGGATGCCTGGGCCAAGGCG
TTGCAGGACCGCGCCGAACTCTCCAGCTTGCAGGACGCGATCCGCCGCCGCGATATACCC
GTACTGAAGGCGATATGGAATCAGCTGGTCAAGGAGTACGACGACCAGTCCTTCTACGGT
TTCCTCGCCACCAGTCCGGCCTTCGCGTCCTTCCGGCACCGGGAGATCTTCGGCCAGGTC
GGTTTCGGCACCGGCGGCTGGGACACGGACTTCCCGAATTCCATTATCGAGATCCTCCGT
GTCGTCTGCACCGCGGCGGACGACGACCAGATGACGATCGAGGGCGGCGCCCAGCAAGTG
CCCCGTGGGCTGTGGACGCTTCGGCCCGACCGGCTCGCGCACTGGCCGGCCGGCACCTCG
CTGGCCGGTCTGCACGGGGGCGCTCCCCGGACCGCGGCCGTGGGCATCCGGCGCGATGCC
GAGGGCTATACGGTGACGGACGCCGACGGACGCCGGGACCGGTATCCGGCCGTGGTGTTC
AGCCCGCACGTCTGGGCCCTGCTCAATCATGTGGACAGCGATCCGGAGCTACTCCCGGCC
GACCTGTGGAGCGCCGTCGAACGCACCCATTACATGGGTTCCTCCAAGGTGTTCGTGCTG
ACGGACCGGCCGTTCTGGCTGGACACCGATCCGGACACCGGCCGGATGGCGATAGGTATG
ACCCTCACGGACCGGATGCCGCGCAGTGTCTACCTCTTCGACTCGGGCCCGGACCGGCCG
GGTGTGATGTGCCTGTCCTACACCTGGAACGACGACTCCCTGAAGTTCGCCACCTTGTCG
GCGGAGCAGCGGCTGGAGCTGCTGCTGACCAAACTGGGCGAGATCTATCCCGGGGTGGAC
ATCCGCTCGCACCTCATCAGCGCACCGCTGACGATCACCTGGGAGACCGAGCCGCGGTTC
ATGGGGGCCTTCAAGGCCAACCTGCCCGGTCACTACCGTTACCAGCGCCGCCTGTTCAGC
CACTTCATGCAGCATGAGCTCGATCCGCGGCATCGCGGCTTCTTCCTGTGCGGCGACGAC
ATCTCCTGGACCGGCGGATTCGCCGAGGGCGCCGTGACCACGGCGCTGAACGCGGTCTGG
GGCGTGGTCAATCACCTCGGCGGCAGCACGGCCCCGGAGAATCCCGGTCCCGGCGATGTC
TTCCACGAGATCGCGCCGGTCCGGCTGCCGGAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002937 Amine oxidase (Domain)
 [49-520]  1.7e-35 PF01593
PF01593   Amino_oxidase
SignalP No significant hit
TMHMM No significant hit