close all open/close all

CDS information : Lydi_00250


close this sectionLocation

Organism
StrainTP-A0598 (=NBRC 110027)
Entry nameLydicamycin
Contig
Start / Stop / Direction115,220 / 116,272 / + [in whole cluster]
115,220 / 116,272 / + [in contig]
Location115220..116272 [in whole cluster]
115220..116272 [in contig]
TypeCDS
Length1,053 bp (350 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative transcriptional regulator
Product (GenBank)putative AsnC family transcriptional regulator
GeneTPA0598_03_00890
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[26380643] Draft genome sequence of marine-derived Streptomyces sp. TP-A0598, a producer of anti-MRSA antibiotic lydicamycins. (Stand Genomic Sci. , 2015)
Family/Domain
FD
IPR019888

close this sectionSequence

selected fasta
>putative transcriptional regulator [putative AsnC family transcriptional regulator]
MSSETEVPRPEQLDEDDLLLANALQTAPRATWSELGKVLGQDAVTLARRWERLSSKGLAW
VTPALGPGLLYRTCRAFVEIHCEPGSAAQVSAELSHQPHVLTLQHVAGTYDLFAIAFTPD
FASMSDYLLTSLPRQEGVVRVRSHLVTRNFRTGSQWRLGVLNQRQERTLLRTGPEPQGAE
ATAYSTWERELIVALSKDGRLRYSDIATELGVTPRTVQRRLNRLLGNRDLLLRCDVARPL
AGWPTGALLWLNVPDERLEEAGRTLGAFPETRSCAALSGANNLLVTVTLHSVDALHDWAV
QLRQALPYAQIADRSVVLRQDKLCGHLLDVWGRSRGVVPLDIWRPSGLSR
selected fasta
>putative transcriptional regulator [putative AsnC family transcriptional regulator]
GTGAGCAGCGAAACCGAGGTGCCGCGTCCGGAGCAGCTGGACGAGGACGATCTGCTGCTG
GCCAACGCCCTCCAGACCGCGCCCCGCGCGACATGGAGCGAGCTGGGAAAGGTGCTCGGC
CAGGACGCGGTGACACTGGCCCGCCGATGGGAGCGCCTCAGCAGCAAGGGCCTGGCCTGG
GTCACCCCCGCGCTGGGCCCCGGTCTCCTCTACCGGACGTGCCGGGCCTTCGTCGAAATC
CACTGCGAGCCGGGCAGCGCCGCTCAGGTATCGGCCGAGCTGTCCCACCAGCCCCACGTG
CTCACCCTCCAGCATGTCGCCGGCACCTATGACCTGTTCGCGATCGCCTTCACCCCGGAC
TTCGCCTCGATGTCCGACTACCTCCTCACGAGCCTGCCCCGGCAGGAGGGCGTCGTCCGG
GTCCGTTCCCATCTGGTGACCCGCAACTTCCGCACGGGATCGCAATGGCGCCTGGGCGTG
CTGAACCAGCGCCAGGAGCGGACCCTGCTCCGCACCGGGCCGGAACCGCAGGGCGCCGAG
GCCACCGCGTACAGCACCTGGGAGCGCGAACTGATCGTCGCGCTGAGCAAAGACGGCCGG
CTCCGCTACTCCGATATCGCCACCGAGCTGGGCGTCACACCCCGGACCGTGCAGCGCCGG
CTGAACCGGCTGCTGGGCAACCGCGACCTGCTCCTGCGCTGCGATGTCGCCCGCCCCCTC
GCGGGCTGGCCGACCGGCGCCCTGCTGTGGCTCAACGTCCCGGACGAGCGGCTGGAGGAG
GCCGGCCGTACGCTCGGTGCCTTCCCGGAGACCCGCAGCTGCGCGGCGCTGTCCGGCGCG
AACAACCTGCTGGTCACCGTCACCCTGCACTCGGTGGACGCGCTCCACGACTGGGCGGTG
CAGCTGCGCCAGGCGCTGCCGTACGCGCAGATCGCGGACCGTTCCGTGGTGCTGCGCCAG
GACAAGCTGTGCGGTCATCTGCTGGATGTGTGGGGACGAAGCCGTGGCGTCGTCCCCCTC
GACATCTGGCGGCCGAGCGGCCTCAGCCGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011008 Dimeric alpha-beta barrel (Domain)
 [72-151]  8.2e-14 SSF54909 [243-327]  6.3e-07 SSF54909
SSF54909   Dimeric alpha+beta barrel
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [11-58]  0.0003 G3DSA:1.10.10.10 [188-225]  3e-07 G3DSA:1.10.10.10
G3DSA:1.10.10.10   no description
IPR019887 Transcription regulator AsnC-type, C-terminal (Domain)
 [78-148]  4.6e-10 PF01037
PF01037   AsnC_trans_reg
 [76-150]  1.2e-11 G3DSA:3.30.70.920
G3DSA:3.30.70.920   no description
IPR019888 Transcription regulator AsnC-type (Family)
 [13-118]  0.00038 SM00344 [189-289]  0.00021 SM00344
SM00344   helix_turn_helix ASNC type
SignalP No significant hit
TMHMM No significant hit