close all open/close all
Lydi_00250 Lydi_00250   last last

CDS information : Lydi_00260


close this sectionLocation

Organism
StrainTP-A0598 (=NBRC 110027)
Entry nameLydicamycin
Contig
Start / Stop / Direction117,752 / 116,262 / - [in whole cluster]
117,752 / 116,262 / - [in contig]
Locationcomplement(116262..117752) [in whole cluster]
complement(116262..117752) [in contig]
TypeCDS
Length1,491 bp (496 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative amidase
Product (GenBank)putative amidase
GeneTPA0598_03_00900
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[26380643] Draft genome sequence of marine-derived Streptomyces sp. TP-A0598, a producer of anti-MRSA antibiotic lydicamycins. (Stand Genomic Sci. , 2015)
Related Reference
ACC
Q93LE2
PmId
[12521300] Expression, purification, and crystallization of glutamyl-tRNA(Gln) specific amidotransferase from Bacillus stearothermophilus. (Mol Cells. , 2002)

close this sectionSequence

selected fasta
>putative amidase [putative amidase]
MTENDLLWLPARELVELQRRREVSAREILDAHLAQIDAVNPKVNAIITLAEDRAHELAAR
ADAAVARGELLGPLHGLPVAHKDLAPTKGIRTTYGSPLYAGHVPDHDALVVEQLVHAGAV
TVGKTNVPEFGAGIQSTNELFGPTRNPYDLSLTAGGSSGGAAAAVATGMVALADGGDTGG
SLRNPAAFCNVVGLRPSVGTVPMWPATDPFAPLSIQGPIGRTVDDVALQMAVLTRADPRS
PWGLGDPSRFHAGLEDDFSDVPVAWSPDLGGQLAVDDAVRTAMEPVPGALAGISRKVGVA
APDMTGADEAFRTLRGWYRALNYGDRYAANPEAFGIRVRQDIESGLATTSAGLMRAHKLR
GLLFQRFVEFTREYRYLVTVTTQVLPWSADQLWPERIGHTRSENYLDCMRSMYWFTVLGV
PALSVPAGFTADGLPVGVQIVGRSGDDLGVLRLARQIERTLGAGLRRPAVALPVTGGGTD
GVRVTGGGTGSARVTG
selected fasta
>putative amidase [putative amidase]
GTGACCGAGAATGACCTCCTGTGGCTGCCGGCCCGGGAACTGGTGGAGCTCCAGCGGCGC
CGTGAGGTGTCGGCGCGCGAGATCCTTGATGCGCACCTCGCCCAGATCGACGCGGTGAAC
CCGAAGGTCAACGCGATCATCACGCTCGCCGAGGACCGCGCCCATGAGCTCGCCGCCCGC
GCCGATGCCGCCGTCGCACGGGGCGAGCTGCTGGGCCCGCTGCACGGCCTCCCGGTCGCG
CACAAGGACCTCGCCCCGACCAAAGGCATCCGGACGACGTACGGTTCTCCGCTCTACGCC
GGCCATGTGCCGGACCATGACGCGTTGGTCGTGGAGCAGTTGGTGCACGCGGGGGCCGTC
ACGGTGGGCAAGACCAATGTGCCCGAGTTCGGTGCGGGCATCCAGAGCACCAACGAGCTG
TTCGGCCCCACCCGCAACCCGTACGACCTGAGCCTGACGGCCGGTGGCAGCAGCGGGGGT
GCGGCGGCCGCCGTCGCGACGGGCATGGTGGCCCTCGCCGACGGCGGTGACACCGGCGGC
TCGCTGCGCAACCCGGCGGCCTTCTGCAATGTGGTGGGGCTGCGGCCCTCGGTGGGCACG
GTTCCGATGTGGCCGGCCACCGATCCGTTCGCGCCGCTGAGCATCCAGGGCCCGATCGGC
CGCACCGTCGACGATGTCGCGCTCCAGATGGCGGTGCTGACCCGGGCCGATCCGAGGTCC
CCCTGGGGCCTGGGCGATCCGTCCCGGTTCCATGCCGGTCTGGAGGACGACTTCTCGGAC
GTACCGGTGGCGTGGAGTCCGGACCTCGGCGGCCAACTGGCGGTGGACGACGCCGTACGC
ACCGCGATGGAGCCGGTGCCCGGGGCCCTGGCCGGGATCTCCCGCAAGGTCGGCGTCGCG
GCCCCGGACATGACCGGCGCCGACGAGGCGTTTCGCACACTGCGCGGCTGGTACCGGGCG
CTCAACTACGGTGACCGGTACGCCGCGAACCCGGAGGCCTTCGGCATCAGGGTGCGCCAG
GACATCGAGAGCGGGCTGGCGACGACCTCGGCCGGTCTGATGCGCGCACACAAGCTGCGC
GGGCTGCTCTTCCAGCGGTTCGTGGAATTCACCCGCGAGTACCGCTATCTGGTGACGGTC
ACGACCCAGGTGCTGCCGTGGAGCGCGGATCAGCTGTGGCCGGAGCGCATCGGGCACACC
AGGAGCGAGAACTATCTCGACTGCATGCGCTCCATGTACTGGTTCACGGTGCTCGGTGTG
CCCGCCCTGTCGGTGCCGGCCGGCTTCACGGCGGACGGGCTGCCGGTCGGGGTGCAGATC
GTCGGGCGCAGCGGCGACGACCTCGGCGTGCTGCGGCTGGCCCGGCAGATCGAGCGGACG
CTCGGTGCGGGGCTGCGGCGGCCGGCCGTCGCGCTCCCGGTCACCGGCGGCGGTACGGAC
GGCGTACGCGTCACCGGCGGCGGTACGGGCAGCGCCCGCGTCACCGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000120 Amidase (Family)
 [27-451]  3.8e-96 PF01425
PF01425   Amidase
IPR020556 Amidase, conserved site (Conserved_site)
 [155-186]  PS00571
PS00571   AMIDASES
IPR023631 Amidase signature domain (Domain)
 [1-470]  5.8e-120 SSF75304
SSF75304   Amidase signature (AS) enzymes
 [2-468]  1.5e-119 G3DSA:3.90.1300.10
G3DSA:3.90.1300.10   no description
SignalP No significant hit
TMHMM No significant hit
Lydi_00250 Lydi_00250   last last