close all open/close all
first first   MUP_00020 MUP_00020

CDS information : MUP_00010


close this sectionLocation

Organism
StrainAgy99
Entry nameMycolactone
Contig
Start / Stop / Direction1 / 1,107 / + [in whole cluster]
1 / 1,107 / + [in contig]
Location1..1107 [in whole cluster]
1..1107 [in contig]
TypeCDS
Length1,107 bp (368 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)probable replication protein Rep
Gene
Gene (GenBank)rep
EC number
Keyword
Note
Note (GenBank)
  • MUP001, rep, len: 368 aa. Probable rep, similar to the Rep proteins on several Mycobacterial plasmids e.g. O32860 Rep of the plasmid pJAZ38 from Mycobacterium fortuitum (see Gavigan et al., 1997) (368 aa), fasta scores: opt: 1692, E(): 1.7e-96, (68.306% identity in 366 aa overlap); and Q938A1 RepA of the plasmid pVT2 from Mycobacterium avium (391 aa), fasta scores: opt: 1283, E(): 2.6e-71, (55.556% identity in 360 aa overlap); and Q48888 Rep of the plasmid pLR7 from Mycobacterium avium (360 aa). Also weakly similar to Q9ZHK2 Putative replication protein of the plasmid pSOX from Rhodococcus sp. X309 (368 aa), fasta scores: opt: 272, E(): 4.1e-09, (36.022% identity in 372 aa overlap). Contains Prosite match to entry PS50310 Alanine-rich region.

close this sectionSequence

selected fasta
>[probable replication protein Rep]
MPAPSVFVGLELDTNSYTGVPCWSAGPAHWAHNTVAVAYDLRYQQIRSLMCDGGIARKTL
IVIAAAMARHADWSTGRNCRPTNNQLEAATGFHQRTIQRAHECLRLLGVATEVLRGRQRT
YIERMASWRMGDRHRGWASVWALHDNGEVARVVHSLSPHLERSSVTTHTSPKTSLFTTHP
GATRARESGATRRNSPDARGRRLAAQWRADPHAPPWTRRYSPTSWSAMLAAPAAAGWTAR
DLTALVQDWLGTGHRIPSTPARPIALLGTLLAWHTSHNSIQHRPAALEEAREAADLAAVR
KRIQKQTAEHHANLAAREAGRAALGGPGHQAARIAAAAAARNAARRRTKMVAAEVASVDA
AIRRARGR
selected fasta
>[probable replication protein Rep]
ATGCCAGCACCGAGCGTGTTTGTCGGCCTGGAACTCGACACCAACAGTTACACCGGTGTG
CCGTGCTGGAGCGCTGGCCCCGCCCACTGGGCCCACAACACCGTCGCGGTGGCCTACGAC
CTGCGCTATCAACAGATCCGGTCGCTGATGTGTGACGGCGGCATCGCCCGAAAAACCCTG
ATCGTCATCGCCGCGGCCATGGCACGTCACGCCGACTGGAGCACCGGCCGCAACTGCCGG
CCCACCAACAACCAGCTCGAAGCCGCGACAGGCTTCCACCAGCGCACCATCCAGCGGGCC
CACGAATGCCTACGCCTACTCGGGGTGGCTACCGAGGTGCTGCGCGGCCGCCAACGCACC
TACATCGAGCGCATGGCCTCCTGGAGAATGGGCGATCGCCACCGCGGCTGGGCGTCCGTG
TGGGCACTACACGACAACGGCGAGGTCGCACGGGTTGTCCACAGCTTGTCACCCCACCTG
GAACGGTCCTCAGTAACCACACACACCTCACCTAAAACAAGCCTGTTTACTACCCACCCG
GGCGCCACACGCGCCCGGGAAAGCGGCGCTACGCGCCGCAACAGCCCAGACGCCCGGGGC
CGGCGACTTGCGGCTCAATGGCGAGCAGACCCCCATGCTCCCCCATGGACTCGTCGGTAC
AGCCCTACGAGCTGGTCAGCAATGCTCGCTGCCCCCGCAGCCGCAGGTTGGACTGCACGC
GACCTGACCGCATTGGTACAAGACTGGCTCGGTACCGGTCACCGAATACCGTCCACTCCA
GCGCGCCCGATCGCCCTGCTCGGCACACTGCTTGCTTGGCATACCAGCCACAACAGCATC
CAACACCGCCCAGCTGCACTCGAGGAAGCACGCGAGGCCGCAGACCTGGCCGCGGTTCGC
AAACGGATTCAAAAACAAACCGCTGAACACCACGCCAACCTCGCGGCGCGAGAAGCCGGC
CGCGCCGCACTGGGCGGTCCCGGCCACCAGGCCGCCAGAATTGCTGCCGCTGCTGCTGCT
CGCAACGCCGCCCGACGGCGCACCAAAATGGTCGCGGCAGAAGTAGCGAGCGTCGATGCG
GCGATCCGGCGGGCCCGCGGCCGCTAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP
 [1-30]  0.233 Signal
Bacteria, Gram-negative   
TMHMM No significant hit
first first   MUP_00020 MUP_00020