close all open/close all

CDS information : MUP_00030


close this sectionLocation

Organism
StrainAgy99
Entry nameMycolactone
Contig
Start / Stop / Direction1,694 / 2,290 / + [in whole cluster]
1,694 / 2,290 / + [in contig]
Location1694..2290 [in whole cluster]
1694..2290 [in contig]
TypeCDS
Length597 bp (198 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • MUP003, -, len: 198 aa. Hypothetical protein. Contains a helix turn helix motif between aa 30->51, Standard_deviations: 4.86, score 1665.00.

close this sectionSequence

selected fasta
>[hypothetical protein]
MSRKWRRTLLTYPLLRKNGTVSSPSEPSAYTLADAGKQLGVTAQRVSQMLSSGELTGPQY
PQQRVPKNAVRVWKWSLDQELARRRSTPPPRHSRRQQPDPGADQGYLAQWWSRREARVNA
AAHELKVAADLARQHASDERRKARQLMSKLARLTIQQAELIERLKDDLAVESERTEQIID
AYSDALTQLLAPDFGPPP
selected fasta
>[hypothetical protein]
GTGTCACGAAAGTGGCGCAGGACTTTACTTACATACCCCCTCCTGCGCAAGAATGGGACC
GTGTCATCGCCCAGCGAACCGTCGGCGTATACGCTCGCCGATGCCGGCAAGCAGTTGGGC
GTCACCGCCCAGCGCGTGAGCCAAATGCTGAGCAGCGGCGAGCTGACAGGCCCGCAATAT
CCACAACAACGGGTTCCCAAGAACGCGGTGCGCGTCTGGAAATGGTCGCTCGACCAGGAG
TTGGCACGAAGAAGGTCCACTCCCCCGCCACGTCACTCACGCAGACAACAACCCGACCCC
GGTGCCGATCAGGGGTACCTCGCGCAATGGTGGAGCCGCCGGGAAGCGCGCGTCAACGCC
GCTGCGCACGAACTCAAAGTTGCCGCAGACCTCGCTCGACAGCATGCCAGCGACGAGCGT
CGAAAAGCCCGACAGCTGATGTCGAAGCTCGCGCGACTGACCATCCAGCAGGCTGAACTC
ATCGAACGGCTAAAAGACGACCTCGCAGTGGAATCGGAACGTACCGAACAGATCATCGAT
GCTTACTCCGATGCCTTAACCCAGCTCCTGGCCCCCGACTTCGGCCCACCACCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP
 [1-29]  0.57 Signal
Bacteria, Gram-positive   
TMHMM No significant hit