close all open/close all

CDS information : MUP_00040


close this sectionLocation

Organism
StrainAgy99
Entry nameMycolactone
Contig
Start / Stop / Direction2,924 / 2,310 / - [in whole cluster]
2,924 / 2,310 / - [in contig]
Locationcomplement(2310..2924) [in whole cluster]
complement(2310..2924) [in contig]
TypeCDS
Length615 bp (204 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • MUP004c, -, len: 204 aa. Hypothetical protein. An alternative start site exists at nt 2588.

close this sectionSequence

selected fasta
>[hypothetical protein]
MSKLTPQELPEADLADLTKPKSRGAGLADLVNAAQPRPASAPEQAAVEVPVEDRPVAATP
SKTSDVSAAKVPARKPGRPRTRSKPTTAVYVSPGVKSRFEKYRHNVKSTNLHVVLEAISI
KYQAGELAEIIEKSRYSTAPTHDLFPADPSAVRYLGGGSAQIAFSLTAEQEEVIDTIGSK
LGFDTRSTWIAPVLNAFLPGRKDA
selected fasta
>[hypothetical protein]
GTGAGCAAGTTAACGCCGCAGGAGCTGCCCGAAGCGGATCTCGCAGACCTCACAAAGCCG
AAGAGTCGCGGCGCTGGTCTAGCTGACCTCGTCAACGCAGCCCAGCCTCGGCCCGCCAGT
GCTCCCGAACAGGCTGCTGTCGAGGTACCTGTTGAGGACAGACCGGTTGCCGCAACGCCC
TCTAAGACCTCTGATGTCTCGGCCGCCAAAGTGCCCGCACGCAAGCCTGGCCGGCCACGC
ACTCGGTCCAAGCCGACCACGGCGGTATATGTCAGTCCTGGCGTCAAGAGCCGCTTCGAG
AAGTATCGGCACAACGTGAAGTCAACCAATTTGCATGTGGTTTTGGAGGCGATCAGCATC
AAGTACCAGGCTGGTGAACTGGCCGAGATCATCGAGAAGAGCCGGTACTCGACTGCACCT
ACCCACGACCTTTTCCCGGCCGACCCTTCGGCCGTGCGCTATCTCGGTGGTGGCAGCGCG
CAGATCGCGTTTAGTCTGACCGCCGAGCAAGAGGAGGTCATCGACACCATCGGCTCAAAG
TTGGGATTCGATACCCGATCGACGTGGATCGCCCCTGTGCTCAATGCGTTCCTGCCCGGC
AGGAAGGACGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP
 [1-41]  0.188 Signal
Bacteria, Gram-negative   
 [1-41]  0.378 Signal
Bacteria, Gram-positive   
TMHMM No significant hit