close all open/close all

CDS information : MUP_00050


close this sectionLocation

Organism
StrainAgy99
Entry nameMycolactone
Contig
Start / Stop / Direction3,901 / 2,921 / - [in whole cluster]
3,901 / 2,921 / - [in contig]
Locationcomplement(2921..3901) [in whole cluster]
complement(2921..3901) [in contig]
TypeCDS
Length981 bp (326 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)possible chromosome partitioning protein ParA
Gene
Gene (GenBank)parA
EC number
Keyword
Note
Note (GenBank)
  • MUP005c, parA, len: 326 aa. Possible parA, chromosome partitioning protein, similar to several e.g. O05189|PARA_CAUCR Chromosome partitioning protein parA from Caulobacter crescentus (267 aa), fasta scores: opt: 279, E(): 4.3e-10, (29.918% identity in 244 aa overlap); Q8G6J3|AAN24469 Chromosome partitioning protein P from Bifidobacterium longum (336 aa), fasta scores: opt: 324, E(): 7.3e-13, (30.085% identity in 236 aa overlap) and Q8KBD6 ATPase, ParA family from Chlorobium tepidum (265 aa), fasta scores: opt: 285, E(): 1.8e-10, (28.807% identity in 243 aa overlap). Contains a Pfam match to entry PF00991, ParA family ATPase.

close this sectionSequence

selected fasta
>[possible chromosome partitioning protein ParA]
MSRSVAVWDDAGLVEPAVNWSKLGNVYLFANGKGGVGKSTCSTHSAALVASDGARALLVD
LNGQGNVANMLGFANTEADDKGRNLYSAITAGAALTPIPDVRPGLDVVPGGPFVRRIAPV
MAAEMGNPQTAKQVLMSLALALAQISDHYGVIFIDSPPENQLLLQAALCASRFVVVPMKT
DDLSRTGLRELAGDLRAMREHNPSVVLLGCFVFASGTSSTRIREEMKKNVAADLGQNDDV
MLDSFIRHSEAVGRDVPKFGRLAHELEQEIVNNPSRSAIRQGRADATTVVSTTSVSVAED
FAKLTGEILTRGSKIRQDLINEGVWP
selected fasta
>[possible chromosome partitioning protein ParA]
ATGAGTAGAAGCGTAGCCGTTTGGGACGACGCTGGGCTGGTAGAACCCGCGGTCAATTGG
AGCAAGCTGGGCAATGTTTATCTGTTCGCCAACGGCAAGGGTGGGGTAGGGAAGTCGACG
TGTTCTACCCACAGCGCCGCGCTCGTTGCCTCCGATGGAGCGCGCGCCTTATTGGTCGAT
CTCAACGGCCAGGGCAACGTGGCGAACATGCTTGGCTTCGCGAATACAGAAGCCGACGAC
AAGGGTAGGAATCTCTACAGCGCGATTACTGCCGGCGCTGCGTTGACCCCGATTCCCGAT
GTCCGTCCGGGATTGGATGTTGTTCCCGGTGGGCCTTTCGTCCGTCGGATCGCGCCGGTG
ATGGCTGCAGAGATGGGCAACCCGCAGACTGCCAAACAGGTGCTGATGTCGCTGGCGCTG
GCGTTGGCACAGATCAGTGATCATTACGGGGTTATCTTCATTGATTCCCCTCCGGAGAAC
CAGTTGCTTCTTCAGGCGGCCCTGTGTGCGTCGCGGTTTGTTGTAGTTCCGATGAAGACC
GATGACCTATCAAGGACCGGACTGCGCGAGTTGGCAGGCGATCTAAGGGCGATGCGCGAG
CACAACCCATCTGTGGTGTTGCTCGGCTGTTTCGTGTTTGCGTCAGGAACTTCATCGACG
AGGATCCGGGAAGAGATGAAGAAGAATGTGGCTGCAGATTTGGGGCAGAACGATGACGTG
ATGCTCGATTCGTTCATCCGCCACTCAGAAGCTGTTGGCAGGGACGTGCCTAAGTTTGGT
CGGTTGGCCCACGAACTTGAGCAGGAAATCGTCAATAATCCGTCTCGGTCAGCGATACGG
CAGGGGAGAGCAGATGCGACTACGGTCGTCAGCACGACATCTGTGAGCGTGGCCGAGGAC
TTCGCCAAGCTGACCGGAGAAATTCTCACGCGGGGTTCAAAGATCCGCCAGGACCTGATC
AACGAAGGAGTGTGGCCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002586 CobQ/CobB/MinD/ParA nucleotide binding domain (Domain)
 [29-252]  7e-17 PF01656
PF01656   CbiA
SignalP No significant hit
TMHMM No significant hit