close all open/close all

CDS information : MUP_00060


close this sectionLocation

Organism
StrainAgy99
Entry nameMycolactone
Contig
Start / Stop / Direction6,386 / 5,640 / - [in whole cluster]
6,386 / 5,640 / - [in contig]
Locationcomplement(5640..6386) [in whole cluster]
complement(5640..6386) [in contig]
TypeCDS
Length747 bp (248 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • MUP006c, -, len: 248 aa. Hypothetical protein.

close this sectionSequence

selected fasta
>[hypothetical protein]
MSTQLKQLRAFLAAAGYPDPAAVTQERTIWAAVQHLTPTSRICSASSMRQAATVIDPEIL
KAVQTVYSTDLGLPEEWTPAQRMEFLTAEADKISSMAASMAETLWEQAITAWTRSRNGQT
PNHATKVALLGDARAQAVTRVLNSELYELIETEETDETDMSPPQSGQPIPHRNQVDWQQR
WTNPIYQSDPTPDLKALIDRLWPASDFSAPRRWWPPCARSLTSLRPPVVRRWEWEELAGD
DRPHGKAK
selected fasta
>[hypothetical protein]
ATGAGCACGCAGCTAAAGCAGCTACGTGCGTTCTTGGCCGCCGCCGGCTACCCAGATCCC
GCCGCTGTCACCCAGGAGAGGACAATATGGGCCGCCGTACAACACCTGACCCCGACCAGC
CGGATCTGTTCAGCATCCTCGATGAGACAGGCAGCCACAGTGATCGATCCCGAGATCCTG
AAAGCAGTACAGACGGTCTACTCGACCGATCTGGGCTTGCCCGAAGAATGGACGCCAGCC
CAACGGATGGAATTTCTGACCGCCGAAGCCGACAAGATCAGCTCGATGGCGGCCAGCATG
GCCGAGACCCTGTGGGAGCAGGCGATCACGGCATGGACCCGCAGCCGCAACGGCCAAACC
CCCAACCACGCAACCAAGGTGGCCCTGCTCGGCGACGCTCGGGCACAAGCGGTCACGAGA
GTACTCAACAGCGAACTCTACGAATTGATCGAGACCGAGGAGACCGACGAGACCGACATG
TCGCCGCCACAGAGCGGACAGCCGATCCCGCATCGGAACCAGGTGGACTGGCAGCAACGG
TGGACAAACCCGATCTACCAAAGCGACCCCACCCCAGATCTCAAAGCCCTGATCGACCGC
CTGTGGCCGGCGTCGGACTTTTCGGCACCTCGGCGGTGGTGGCCGCCGTGCGCGCGGAGC
CTAACATCTCTGCGGCCGCCGGTGGTGCGCCGATGGGAATGGGAGGAGCTAGCGGGCGAC
GATCGGCCGCACGGCAAGGCCAAGTAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP
 [1-21]  0.368 Signal
Bacteria, Gram-positive   
 [1-15]  0.462 Signal
Bacteria, Gram-negative   
TMHMM No significant hit