close all open/close all

CDS information : MUP_00070


close this sectionLocation

Organism
StrainAgy99
Entry nameMycolactone
Contig
Start / Stop / Direction6,604 / 6,383 / - [in whole cluster]
6,604 / 6,383 / - [in contig]
Locationcomplement(6383..6604) [in whole cluster]
complement(6383..6604) [in contig]
TypeCDS
Length222 bp (73 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)conserved hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • MUP007c, -, len: 73 aa. Conserved hypothetical protein, some similarity to O33270|Rv0340 Hypothetical protein from M. tuberculosis (179 aa), fasta scores: opt: 88, E(): 21, (32.558% identity in 43 aa overlap); and Q8KKW1 Hypothetical protein on the symbiotic plasmid p42d from Rhizobium etli (108 aa), fasta scores: opt: 92, E(): 7.1, (58.333% identity in 24 aa overlap); and O52677 Core protein (Fragment) from Escherichia coli (193 aa), fasta scores: opt: 91, E(): 13, (31.818% identity in 66 aa overlap).

close this sectionSequence

selected fasta
>[conserved hypothetical protein]
MNAIQHVGHDDRCRGQMMGRRRHRFEPQHVNTTIRQTNQSIGILESQETPPGVGMAAQAR
RPTVGQPARACGA
selected fasta
>[conserved hypothetical protein]
ATGAACGCAATCCAGCACGTGGGCCACGACGATCGGTGCCGGGGCCAGATGATGGGTCGC
CGGCGACACCGCTTTGAGCCGCAGCACGTGAACACCACCATCCGCCAGACGAACCAGTCC
ATAGGCATCCTCGAATCGCAGGAAACACCGCCAGGTGTGGGTATGGCCGCGCAAGCGCGA
AGACCCACTGTCGGCCAGCCGGCGAGAGCTTGCGGCGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP No significant hit
TMHMM No significant hit