close all open/close all

CDS information : MUP_00080


close this sectionLocation

Organism
StrainAgy99
Entry nameMycolactone
Contig
Start / Stop / Direction7,160 / 6,612 / - [in whole cluster]
7,160 / 6,612 / - [in contig]
Locationcomplement(6612..7160) [in whole cluster]
complement(6612..7160) [in contig]
TypeCDS
Length549 bp (182 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)possible nucleic acid binding protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • MUP008c, -, len: 182 aa. Possible nucleic acid binding protein, similar to the C-terminus of several N utilization substance proteins e.g. O05818|NUSA_MYCTU|Rv2841c N utilization substance protein A from M. tuberculosis (347 aa), fasta scores: opt: 337, E(): 6.5e-14, (42.143% identity in 140 aa overlap); Q9HV54 N utilization substance protein A from Pseudomonas aeruginosa (493 aa), fasta scores: opt: 353, E(): 7.9e-15, (38.255% identity in 149 aa overlap); etc. Contains a possible Pfam match to entry PF00013 KH domain.

close this sectionSequence

selected fasta
>[possible nucleic acid binding protein]
MGPTAALFSQAKMPQGDSAVRQLAHSAMISPNPIPAALSARVPELAQQLVDIVAIARIPG
VRAKVAVRSRVAGINPVSVCIGWGGLRIADVEKGLGGERIHVVAYHVDPATYVINVLGCP
GTGTGAAAAAEERSRRIRVRVEAHDYPRTVGKAGQNVRLASKLTGQKIEILVEKSCTADC
FA
selected fasta
>[possible nucleic acid binding protein]
ATGGGCCCAACAGCAGCGCTCTTCTCGCAGGCAAAGATGCCCCAGGGTGACAGCGCAGTG
CGCCAGCTCGCCCACTCTGCGATGATCAGCCCCAACCCCATCCCCGCCGCCTTGAGTGCG
CGGGTGCCTGAACTGGCCCAGCAGCTCGTTGACATCGTCGCCATCGCACGGATACCGGGA
GTGCGAGCCAAGGTCGCCGTCCGCTCTCGTGTCGCCGGCATCAACCCCGTCAGCGTGTGC
ATCGGCTGGGGCGGCCTGCGCATCGCCGATGTCGAAAAAGGTCTTGGGGGAGAACGGATC
CATGTCGTGGCCTACCATGTCGACCCCGCCACATATGTGATCAATGTCCTCGGCTGCCCC
GGCACCGGCACCGGCGCCGCAGCAGCAGCCGAGGAGCGGTCTCGCCGCATCCGCGTGCGC
GTCGAAGCCCACGACTATCCGCGCACAGTGGGCAAAGCCGGTCAGAACGTGCGCCTTGCA
AGCAAGCTAACGGGTCAGAAGATTGAGATCCTTGTGGAGAAAAGCTGTACTGCAGATTGT
TTCGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004088 K Homology domain, type 1 (Domain)
 [134-170]  PS50084
PS50084   KH_TYPE_1
IPR009019 K Homology, prokaryotic type (Domain)
 [29-106]  7.60000011115812e-22 SSF54814 [108-176]  2.19999900980708e-08 SSF54814
SSF54814   KH_prok
IPR015946 K homology domain-like, alpha/beta (Domain)
 [34-105]  4.70000000000001e-22 G3DSA:3.30.300.20 [108-173]  7.20000000000001e-13 G3DSA:3.30.300.20
G3DSA:3.30.300.20   KH_prok
IPR025249 KH domain, NusA-like (Domain)
 [59-117]  6.1e-13 PF13184
PF13184   KH_5
SignalP
 [1-18]  0.048 Signal
Eukaryota   
 [1-36]  0.33 Signal
Bacteria, Gram-positive   
TMHMM No significant hit