close all open/close all

CDS information : MUP_00090


close this sectionLocation

Organism
StrainAgy99
Entry nameMycolactone
Contig
Start / Stop / Direction7,188 / 7,616 / + [in whole cluster]
7,188 / 7,616 / + [in contig]
Location7188..7616 [in whole cluster]
7188..7616 [in contig]
TypeCDS
Length429 bp (142 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • MUP009, -, 142 aa. Hypothetical protein.

close this sectionSequence

selected fasta
>[hypothetical protein]
MRLGFVDGCGLAGLASHSTRSSRSVAIRSTILYISSGVHGSSRMAQLRTAQRPLTTAQQA
PPLGVAGDAVKGGWAEARRIATAVVGPWETDPTLVHYAQFDSGVVKGPGAVDFRLGSPIG
DALKGHNVIAGFSSAQDRHQPL
selected fasta
>[hypothetical protein]
ATGCGTCTGGGGTTCGTTGATGGTTGCGGGCTGGCGGGGTTGGCCAGCCACTCAACGAGG
TCGTCGAGGTCGGTGGCGATCCGGTCGACCATCTTGTACATCAGTTCCGGGGTGCACGGA
TCGTCGAGGATGGCCCAGCTGCGCACCGCCCAACGACCGCTAACGACCGCCCAGCAGGCT
CCGCCGCTTGGGGTGGCCGGAGATGCCGTCAAGGGCGGCTGGGCCGAGGCACGGCGGATC
GCCACCGCCGTGGTGGGCCCCTGGGAAACAGATCCCACCCTGGTGCACTACGCACAGTTC
GACAGCGGCGTCGTCAAGGGACCTGGCGCGGTCGACTTCCGCTTGGGTTCGCCGATTGGT
GACGCTCTGAAAGGCCACAATGTGATCGCTGGATTTTCGAGCGCGCAAGACCGACACCAA
CCCCTATAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP
 [1-28]  0.37 Signal
Bacteria, Gram-positive   
TMHMM No significant hit