close all open/close all

CDS information : MUP_00100


close this sectionLocation

Organism
StrainAgy99
Entry nameMycolactone
Contig
Start / Stop / Direction7,630 / 8,421 / + [in whole cluster]
7,630 / 8,421 / + [in contig]
Location7630..8421 [in whole cluster]
7630..8421 [in contig]
TypeCDS
Length792 bp (263 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • MUP010, -, len: 263 aa. Hypothetical protein.

close this sectionSequence

selected fasta
>[hypothetical protein]
MVLELPNADEAVETVRAMADNSAALTFPFSAEPFPTEPFSIPRHPDTSAVTFHHDVPAPE
PVGGERFSVVAFTAHGPFVLAQWADAAESADKSAQLIATTLELQEPRIDTFTPTPPDRIS
DLPLDPSGMLSRVLPPEEENKTVDDGVYDHLGIVHFGGDPVRRQAMFKSAGLQQAAYTVT
ADVYEAGDAESAQRIVAELAAEAIDDGLMAATGVQGMPKARCLEGDLAYWCVAAADRYAY
TVQGHEGAVHQMVAAQYRILTGK
selected fasta
>[hypothetical protein]
GTGGTGTTGGAACTGCCGAATGCCGACGAAGCCGTGGAAACGGTGCGCGCGATGGCTGAC
AACAGTGCCGCGCTGACGTTTCCGTTCTCGGCCGAACCGTTTCCGACTGAGCCGTTTTCG
ATCCCGCGCCATCCCGATACTTCGGCGGTCACCTTCCACCACGACGTTCCTGCGCCCGAA
CCCGTTGGAGGAGAGCGGTTTTCAGTGGTTGCATTTACCGCCCACGGGCCTTTTGTGCTG
GCTCAATGGGCTGATGCGGCGGAAAGTGCCGACAAGTCTGCCCAGTTGATCGCCACCACC
CTGGAGCTGCAGGAGCCGCGGATTGACACGTTCACGCCGACCCCGCCTGATCGGATCTCG
GATCTGCCGTTGGATCCCAGCGGTATGCTGTCGCGCGTTTTGCCGCCCGAGGAGGAGAAC
AAGACTGTCGATGACGGCGTCTACGACCACCTAGGGATCGTGCACTTCGGCGGTGATCCT
GTCCGCCGTCAGGCGATGTTCAAGTCCGCAGGCTTGCAGCAGGCTGCTTACACCGTTACC
GCTGACGTCTACGAGGCCGGCGACGCGGAGTCCGCTCAGCGCATCGTTGCCGAGTTGGCG
GCCGAAGCGATCGATGACGGCTTGATGGCGGCCACCGGTGTGCAGGGTATGCCCAAGGCC
CGCTGCCTGGAGGGAGACCTGGCGTATTGGTGCGTGGCGGCCGCGGACCGCTACGCCTAT
ACGGTGCAGGGGCACGAGGGCGCCGTGCATCAGATGGTCGCGGCGCAATACCGGATCCTG
ACGGGGAAGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP No significant hit
TMHMM No significant hit