close all open/close all

CDS information : MUP_00110


close this sectionLocation

Organism
StrainAgy99
Entry nameMycolactone
Contig
Start / Stop / Direction8,430 / 10,412 / + [in whole cluster]
8,430 / 10,412 / + [in contig]
Location8430..10412 [in whole cluster]
8430..10412 [in contig]
TypeCDS
Length1,983 bp (660 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)probable transmembrane serine/threonine-protein kinase PknQ
Gene
Gene (GenBank)pknQ
EC number2.7.1.-
Keyword
Note
Note (GenBank)
  • MUP011, pknQ, len: 660 aa. Probable pknQ, transmembrane serine/threonine-protein kinase (EC 2.7.1.-), similar to several mycobacterial serine/threonine-protein kinases e.g. Q10697|PKNJ_MYCTU|Rv2088 from M. tuberculosis (589 aa), fasta scores: opt: 1121, E(): 2.9e-43, (43.45% identity in 527 aa overlap); P72003|PKNF_MYCTU|Rv1746 from M. tuberculosis (476 aa), fasta scores: opt: 761, E(): 4.2e-27, (38.661% identity in 463 aa overlap); Q9RLQ7 Putative serine/threonine protein kinase from M. bovis (291 aa), etc. And similar to serine/threonine-protein kinases from other bacteria e.g. Q9XA16 Putative serine/threonine protein kinase from Streptomyces coelicolor (673 aa), fasta scores: opt: 656, E(): 2.9e-22 (36.164% identity in 365 aa overlap). Contains a Prosite matches to entries PS50011 Protein kinase domain and PS00108, Serine/Threonine protein kinases active-site signature pattern. Belongs to the SER/THR family of protein kinases.

close this sectionSequence

selected fasta
>[probable transmembrane serine/threonine-protein kinase PknQ]
MALPLGTVVAGYVIEGVLGSGGMGTVYLARHPTLPRSDALKILSAELSQDEQFRVRFIRE
ADLAATLSHPNIVTVFNRGETDDGQLWIAMQYVEGTTASDLHATVLTPARVAAIITDVGA
ALDYAHSRRVLHRDIKPSNFLVSADHERVLLADFGIARAFDDTTLTAIGSLVGTASYAAP
EAIQGGSVDQRADVYSLGCALFRLLTGRAPYEDLRGPAMLMAHVLQPIPRPSHIVVGLPP
AIDDVIAVAMAKDPAARFPTAGALAGAARAALSGQPLPQAPPGGPKTRIWAAPPLSYPTT
RPPGISGGAISPAGFAGAAHPGLAGAASSSDERGGPRAPRRRKRGIIAAAMGLVTIVAAA
VLAGVLLTEHRGATLAPYQPQSMTGTLGTVELHHRPVAVAALGPGDADAVLSLGVQPVAI
GGTHGQTPSWLAPMVKSSPAMLPTADPATLAETRPDLIIDTGSLDKATYNQLAAIAPTLT
RPADTTQEWNWQNQLTWIATSLGRTTTATTLLNNAVAEQTQIKSDNPAFSGKTITVVNLS
DTTTTVATKVSPPTAYLEGLGFAYNVYFKRGPNDPPEVEVDEDSFDWGRAKMTDVMIVIR
TDRAAGGGGFGGLPSKFALFNEPLVIVDDLATITALNSGGPAATTYLDTTLVNKLAHQIH
selected fasta
>[probable transmembrane serine/threonine-protein kinase PknQ]
GTGGCGTTGCCTTTAGGAACCGTGGTGGCCGGCTATGTCATCGAGGGGGTGCTCGGTTCC
GGCGGCATGGGGACGGTTTACCTGGCGCGACATCCCACGCTGCCGCGCTCTGATGCCCTC
AAGATCTTGTCCGCCGAGCTGTCTCAGGATGAACAATTTCGGGTGCGGTTCATCCGCGAA
GCCGACCTGGCCGCGACACTGAGCCACCCCAATATCGTCACCGTGTTCAACCGCGGCGAA
ACCGACGACGGTCAGCTGTGGATAGCGATGCAATACGTCGAGGGAACTACCGCGTCGGAT
CTGCACGCGACGGTACTGACCCCGGCGCGGGTGGCCGCGATCATCACTGATGTCGGCGCA
GCGTTGGACTATGCGCATTCGCGCCGTGTGCTACACCGCGACATCAAGCCGTCCAATTTC
TTGGTTAGTGCCGATCACGAACGGGTACTGCTAGCCGATTTCGGCATCGCCCGCGCCTTT
GACGACACCACGTTGACCGCAATCGGCTCGTTGGTCGGCACCGCCTCCTACGCCGCACCC
GAGGCAATCCAAGGTGGTTCGGTCGATCAGCGCGCCGACGTCTATTCGCTGGGATGTGCG
CTGTTCCGGTTGTTGACCGGTCGCGCTCCCTATGAGGACTTGCGAGGGCCGGCGATGCTG
ATGGCCCATGTGCTGCAGCCGATCCCACGCCCCTCCCATATCGTGGTCGGTCTACCGCCG
GCGATCGACGACGTGATCGCTGTGGCGATGGCCAAAGACCCCGCCGCCCGATTCCCCACG
GCCGGGGCACTCGCCGGCGCGGCCCGGGCCGCCCTTTCTGGCCAACCCTTGCCCCAGGCG
CCACCCGGCGGGCCGAAAACCAGGATTTGGGCGGCCCCGCCGCTGTCATATCCGACCACG
CGACCCCCCGGGATCAGTGGCGGTGCCATCTCTCCGGCCGGGTTCGCCGGGGCCGCTCAT
CCCGGCTTAGCAGGCGCGGCCAGTTCTTCTGACGAGCGTGGCGGTCCGCGCGCCCCTCGC
CGGCGCAAGCGAGGAATCATCGCGGCCGCAATGGGGTTGGTTACGATCGTCGCCGCAGCG
GTCCTCGCGGGCGTGCTACTGACTGAGCACCGCGGCGCAACCCTGGCGCCGTATCAGCCG
CAATCGATGACCGGCACATTGGGGACGGTCGAGCTACATCACCGGCCGGTGGCCGTGGCA
GCTCTCGGGCCCGGTGATGCCGACGCGGTGCTATCCCTAGGAGTACAGCCCGTAGCGATC
GGCGGCACCCACGGTCAAACGCCGAGCTGGCTGGCGCCCATGGTGAAATCCTCACCCGCG
ATGCTACCCACGGCGGATCCGGCCACCCTCGCCGAGACGAGGCCGGATCTGATCATCGAC
ACGGGCAGCCTCGACAAAGCCACCTACAACCAGCTGGCGGCCATCGCACCTACCCTGACA
CGGCCCGCCGATACCACCCAAGAGTGGAACTGGCAAAACCAACTCACCTGGATCGCAACC
TCCTTGGGCCGGACCACCACCGCCACAACCCTTCTCAACAACGCCGTCGCCGAACAAACA
CAAATCAAATCCGACAATCCGGCGTTCTCCGGCAAGACCATCACCGTGGTCAACCTGTCA
GACACCACCACCACAGTGGCAACAAAGGTGTCCCCGCCGACCGCCTATCTCGAAGGTCTG
GGATTCGCGTACAACGTCTATTTCAAGCGCGGCCCCAACGATCCACCCGAAGTGGAGGTA
GACGAAGACTCTTTTGACTGGGGCCGCGCGAAAATGACCGATGTCATGATTGTGATCCGC
ACCGACCGGGCCGCCGGAGGCGGCGGATTCGGCGGTCTACCAAGCAAGTTCGCCCTGTTC
AACGAACCGCTCGTTATTGTCGATGACCTTGCCACCATTACCGCGCTCAACAGCGGCGGA
CCAGCAGCCACCACATACCTCGACACGACACTGGTCAACAAACTCGCCCACCAGATCCAC
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000719 Protein kinase, catalytic domain (Domain)
 [12-272]  PS50011
PS50011   PROTEIN_KINASE_DOM
 [12-258]  9.09999999999992e-47 PF00069
PF00069   Pkinase
IPR002491 ABC transporter periplasmic binding domain (Domain)
 [400-562]  8.3e-09 PF01497
PF01497   Peripla_BP_2
IPR008271 Serine/threonine-protein kinase, active site (Active_site)
 [130-142]  PS00108
PS00108   PROTEIN_KINASE_ST
IPR011009 Protein kinase-like domain (Domain)
 [3-265]  1.69998802370953e-67 SSF56112
SSF56112   Kinase_like
SignalP
 [1-19]  0.697 Signal
Eukaryota   
TMHMM
 [5-27]  Transmembrane (o-i) [346-368]  Transmembrane (i-o)
Transmembrane 2