close all open/close all

CDS information : MUP_00120


close this sectionLocation

Organism
StrainAgy99
Entry nameMycolactone
Contig
Start / Stop / Direction10,692 / 10,429 / - [in whole cluster]
10,692 / 10,429 / - [in contig]
Locationcomplement(10429..10692) [in whole cluster]
complement(10429..10692) [in contig]
TypeCDS
Length264 bp (87 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • MUP012c, -, len: 87 aa. Hypothetical protein. Some similarity to Antigen 84 from M. tuberculosis and M. leprae e.g. P46816|AG84_MYCTU|Rv2145c Antigen 84 from M. tuberculosis (260 aa), fasta scores: opt: 105, E(): 4.1, (36.735% identity in 49 aa overlap).

close this sectionSequence

selected fasta
>[hypothetical protein]
MSHSELLDPALPKSPFGKQGYRYDDVDVFLRLIADELQGSDLSESDIHSITFRCAAPLTR
GYDTESVDRFLDRIAETIARGHGDEGQ
selected fasta
>[hypothetical protein]
GTGAGCCACAGTGAACTCCTTGACCCCGCGTTGCCGAAATCGCCGTTCGGAAAACAAGGC
TACCGCTATGACGACGTTGACGTTTTTCTGCGGCTCATCGCCGACGAACTCCAAGGCAGC
GACCTTTCTGAGAGCGACATCCACAGCATCACGTTCCGTTGTGCGGCACCATTGACGCGC
GGATACGACACTGAGTCAGTCGATCGATTCTTGGATCGCATCGCAGAAACGATCGCTCGA
GGTCATGGCGACGAGGGCCAGTAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR019933 DivIVA domain (Domain)
 [42-78]  1.1e-12 TIGR03544
TIGR03544   DivI1A_domain
SignalP No significant hit
TMHMM No significant hit