close all open/close all

CDS information : MUP_00130


close this sectionLocation

Organism
StrainAgy99
Entry nameMycolactone
Contig
Start / Stop / Direction11,147 / 10,689 / - [in whole cluster]
11,147 / 10,689 / - [in contig]
Locationcomplement(10689..11147) [in whole cluster]
complement(10689..11147) [in contig]
TypeCDS
Length459 bp (152 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)possible conserved membrane protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • MUP013c, -, len: 152 aa. Possible conserved membrane protein, some similarity to Q8EX03 Putative integral membrane protein from Mycoplasma penetrans (303 aa), fasta scores: opt: 106, E(): 14, (31.250% identity in 96 aa overlap). Contains two membrane spanning regions towards the N-terminus.

close this sectionSequence

selected fasta
>[possible conserved membrane protein]
MRTSRVLVATLILLVGTTLVVTIVALFQPGSATHEAMPLWWFPTFTSAGLLVSVVPGVAM
ALALLTSKRDWAHANEYRVVLPTVAVGSLFGSLPRCLTGTSGCWAPRCCLRLGLFGSYAD
CHATIAAQFGLRCVVARTHSGAAATRTLSSTR
selected fasta
>[possible conserved membrane protein]
ATGCGAACAAGTCGCGTTCTCGTCGCCACCCTAATTCTGCTGGTCGGTACGACGCTTGTC
GTCACGATCGTGGCCTTGTTCCAGCCCGGCAGCGCGACCCACGAAGCTATGCCGCTGTGG
TGGTTTCCCACATTCACGTCGGCGGGTTTGCTGGTGAGTGTCGTTCCAGGGGTTGCGATG
GCTCTTGCCCTCCTCACGTCCAAGCGAGACTGGGCGCACGCAAACGAATATCGCGTCGTG
CTGCCAACTGTCGCCGTCGGCAGCCTTTTTGGTTCATTGCCCCGCTGCCTAACTGGCACC
TCGGGCTGCTGGGCGCCGCGATGCTGCTTGCGGCTTGGATTGTTTGGGAGCTACGCGGAT
TGTCACGCGACAATTGCCGCGCAATTCGGGCTGCGCTGCGTGGTCGCCCGAACACACTCT
GGGGCAGCCGCGACGAGGACCTTGAGTTCCACTCGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP
 [1-32]  0.999 Signal
Bacteria, Gram-positive   
 [1-32]  0.702 Signal
Eukaryota   
 [1-20]  0.963 Signal
Bacteria, Gram-negative   
TMHMM
 [7-29]  Transmembrane (i-o) [44-66]  Transmembrane (o-i)
Transmembrane 2