close all open/close all

CDS information : MUP_00140


close this sectionLocation

Organism
StrainAgy99
Entry nameMycolactone
Contig
Start / Stop / Direction11,922 / 11,149 / - [in whole cluster]
11,922 / 11,149 / - [in contig]
Locationcomplement(11149..11922) [in whole cluster]
complement(11149..11922) [in contig]
TypeCDS
Length774 bp (257 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putative integral membrane protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • MUP014c, -, len: 257 aa. Putative integral membrane protein, contains several membrane spanning regions. An alternative start codon exists downstream.

close this sectionSequence

selected fasta
>[putative integral membrane protein]
MLISGLWARLVVAPWWVRVLANGLALAGIAVVFTIGFVAHFVSQTNWAWATAAAGATGVG
YGALITSVRGPIHLRFAATVAGLTVQQRGQALTALRRGDVPSDPRVVAAASRLGALMLAY
GRRTHPLQWAFLGAFAAVAVVLRITHSQPGFFCLLLVYLAATPTLIWQRRLLKRLPDRLA
RLHAAASPAIWAAQEQPDPSTMAQQRLLSSALTGFVAGAFAVAALVGTQYVSQPQAAAGD
AQGAALLLAPVTATVGR
selected fasta
>[putative integral membrane protein]
GTGTTGATCTCGGGCTTGTGGGCACGACTTGTCGTGGCGCCATGGTGGGTGCGGGTGCTG
GCGAATGGGCTCGCCCTGGCCGGCATCGCTGTGGTGTTCACGATTGGCTTCGTTGCGCAC
TTTGTGTCCCAAACCAACTGGGCGTGGGCCACTGCGGCCGCGGGGGCGACCGGTGTTGGC
TACGGGGCACTCATCACGTCCGTCAGGGGTCCCATCCACCTGCGCTTTGCCGCCACGGTG
GCTGGGCTCACCGTGCAGCAACGAGGTCAGGCCCTCACGGCGTTGCGTCGCGGTGATGTG
CCGTCGGATCCGCGCGTTGTTGCCGCGGCCAGTCGCTTGGGTGCCCTGATGTTGGCTTAC
GGGCGTCGCACCCACCCGCTGCAATGGGCATTCCTAGGCGCGTTCGCCGCTGTTGCGGTC
GTGCTCAGAATCACCCACAGCCAGCCCGGTTTCTTTTGCCTGCTCTTGGTTTACCTCGCC
GCTACGCCGACATTGATTTGGCAACGTCGCCTCCTCAAGCGGCTCCCCGACCGCCTTGCT
CGGCTGCACGCGGCCGCGTCACCGGCCATATGGGCCGCTCAAGAGCAACCAGACCCCTCG
ACGATGGCCCAGCAGCGCCTACTGTCCAGTGCGCTCACCGGCTTCGTTGCTGGGGCCTTC
GCGGTGGCTGCACTTGTTGGCACACAATATGTTTCACAACCGCAGGCCGCTGCCGGCGAT
GCGCAGGGCGCAGCGCTGCTGCTCGCGCCGGTAACAGCGACTGTAGGCCGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP
 [1-27]  0.46 Signal
Bacteria, Gram-negative   
 [1-58]  0.854 Signal
Eukaryota   
 [1-27]  0.553 Signal
Bacteria, Gram-positive   
TMHMM
 [20-42]  Transmembrane (i-o) [46-68]  Transmembrane (o-i) [127-144]  Transmembrane (i-o) [148-167]  Transmembrane (o-i) [208-230]  Transmembrane (i-o)
Transmembrane 5