close all open/close all

CDS information : MUP_00150


close this sectionLocation

Organism
StrainAgy99
Entry nameMycolactone
Contig
Start / Stop / Direction12,692 / 11,916 / - [in whole cluster]
12,692 / 11,916 / - [in contig]
Locationcomplement(11916..12692) [in whole cluster]
complement(11916..12692) [in contig]
TypeCDS
Length777 bp (258 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)possible secreted protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • MUP015c, -, len: 258 aa. Possible secreted protein, contains probable N-terminal signal sequence.

close this sectionSequence

selected fasta
>[possible secreted protein]
MTDNRSGRAQLVTAMLAVLVMIAITLTAYAVGARWPAHPRQHRLAPGLAALSGERLAELL
PVQTDLPPGWTRYDDPYRRTPAAGFGYHRYHSNGVDWGYQPAECIDVRYGNGHVTPSPAA
EFAQYAPGHPTEVHQVADLQIQISREFNPALFTDMLAQVSRCRRFIARQPFGTARFTVRV
LEDSHPLHGPHRFRYAVTVTYSDDDLLPSETRYVYYARTSRLVVAASDSSGNPQLLDTVF
DKALHQICTRATESRQRC
selected fasta
>[possible secreted protein]
ATGACCGACAACCGCTCGGGCCGGGCACAACTGGTCACCGCCATGCTCGCCGTGCTCGTG
ATGATCGCGATCACGCTAACCGCCTACGCCGTCGGTGCTCGCTGGCCAGCCCACCCGCGC
CAGCATCGGCTGGCGCCTGGGCTGGCTGCGCTCAGCGGTGAACGTCTAGCTGAGCTGCTA
CCAGTGCAGACCGATCTCCCGCCGGGGTGGACACGATACGACGACCCGTACCGCAGGACT
CCCGCCGCCGGCTTCGGCTATCACCGGTATCACTCCAACGGCGTCGATTGGGGCTACCAG
CCGGCCGAATGTATCGATGTCCGGTACGGCAACGGGCACGTGACGCCCTCCCCCGCAGCT
GAATTCGCACAATATGCGCCTGGTCACCCGACCGAGGTCCACCAGGTCGCCGACCTCCAG
ATCCAGATCAGCCGGGAATTCAACCCAGCCCTGTTCACCGACATGCTCGCCCAGGTCTCG
CGGTGTCGGCGGTTCATCGCCCGCCAGCCTTTCGGCACCGCCCGCTTTACGGTGCGTGTC
CTTGAGGACTCGCATCCCTTGCACGGGCCGCACCGCTTCCGCTATGCAGTGACGGTCACC
TACAGCGACGACGACCTGCTGCCCAGTGAAACACGCTATGTCTACTACGCTCGCACATCC
AGACTCGTCGTCGCGGCCTCGGATAGCTCCGGGAACCCCCAACTCCTCGACACCGTTTTC
GACAAGGCGCTGCACCAGATCTGCACCCGGGCTACCGAGAGCAGGCAGCGGTGTTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP
 [1-30]  0.998 Signal
Bacteria, Gram-negative   
 [1-27]  0.612 Signal
Eukaryota   
 [1-30]  0.997 Signal
Bacteria, Gram-positive   
TMHMM
 [11-33]  Transmembrane (i-o)
Transmembrane 1