close all open/close all

CDS information : MUP_00160


close this sectionLocation

Organism
StrainAgy99
Entry nameMycolactone
Contig
Start / Stop / Direction13,480 / 12,689 / - [in whole cluster]
13,480 / 12,689 / - [in contig]
Locationcomplement(12689..13480) [in whole cluster]
complement(12689..13480) [in contig]
TypeCDS
Length792 bp (263 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • MUP016c, -, len: 263 aa. Hypothetical protein. Contains a Prosite match to entry PS00152 ATPASE_ALPHA_BETA ATP synthase alpha and beta subunits signature

close this sectionSequence

selected fasta
>[hypothetical protein]
MMMAASPDPRSTAVRRRGSQRGLAAVALATVGVCGLLLLMVPPPSVNSLLSRSNWELATA
LPAIDAFPADWNYDLWSDIVQPTPAATTGSGPLTTRGSVSQSVPAGCGDVPTLVGLYDGV
SRSAAMVHVDLRTDEIAKAILASSDEPEPNARFVIWRKPNGAQLIADYLGWIGRCGSYRV
TSPPPDNHTTTVTTTVSVESVTGTDAAVIATRSSISSEDSQTYHVMFYALRGVVLECATN
LTGDQVDMVRRLADQTLHRLHTL
selected fasta
>[hypothetical protein]
GTGATGATGGCCGCGTCACCCGATCCGCGGTCAACTGCTGTCCGGCGACGGGGTTCGCAG
CGAGGGCTAGCTGCGGTGGCGCTGGCCACCGTCGGTGTATGCGGGCTGCTGCTGCTGATG
GTTCCACCGCCGTCAGTGAACAGCCTGCTATCCCGGTCGAATTGGGAGCTGGCGACGGCG
TTGCCCGCTATTGACGCGTTCCCGGCCGACTGGAACTACGACCTGTGGAGCGACATCGTG
CAGCCGACCCCGGCCGCCACGACCGGATCCGGGCCGTTGACAACGCGCGGTTCGGTGTCG
CAGTCCGTGCCGGCGGGGTGCGGCGACGTTCCCACATTGGTTGGGCTGTACGACGGCGTG
TCACGCTCGGCGGCAATGGTTCATGTCGACCTCCGCACCGACGAGATCGCCAAAGCCATC
CTTGCCTCGTCGGACGAACCCGAGCCCAACGCCCGGTTTGTGATCTGGCGAAAGCCCAAC
GGAGCGCAACTCATCGCCGACTACCTGGGCTGGATCGGCCGCTGCGGCTCCTACCGCGTC
ACCAGTCCCCCACCGGACAACCACACCACCACGGTCACGACAACGGTCTCCGTCGAATCG
GTGACCGGTACCGATGCCGCGGTGATCGCCACCCGGTCATCGATCAGCTCCGAGGATTCG
CAGACCTATCACGTCATGTTCTATGCGCTGCGTGGCGTGGTGCTGGAGTGCGCCACGAAT
CTCACCGGCGACCAGGTCGACATGGTGCGCCGACTCGCCGACCAGACGCTGCACAGGCTG
CACACCTTATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP
 [1-51]  0.996 Signal
Bacteria, Gram-positive   
 [1-1]  Signal-anchor
Eukaryota   
TMHMM
 [21-43]  Transmembrane (i-o)
Transmembrane 1