close all open/close all

CDS information : MUP_00170


close this sectionLocation

Organism
StrainAgy99
Entry nameMycolactone
Contig
Start / Stop / Direction13,929 / 13,477 / - [in whole cluster]
13,929 / 13,477 / - [in contig]
Locationcomplement(13477..13929) [in whole cluster]
complement(13477..13929) [in contig]
TypeCDS
Length453 bp (150 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)possible conserved transmembrane protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • MUP017c, -, len: 150 aa. Possible conserved transmembrane protein, weakly similar to O06254|Rv3437 possible conserved transmembrane protein from M. tuberculosis (158 aa), fasta scores: opt: 244, E(): 2.3e-05, (38.393% identity in 112 aa overlap). Contains a Prosite match to entry PS50099 PRO_RICH Proline-rich region. Contains hydrophobic region at the C-terminus.

close this sectionSequence

selected fasta
>[possible conserved transmembrane protein]
MSHPYTNAQPHHYPYPNPQHPHPYPYPQRPAYPPPPQVGYYPPHAAAPWTPQPTAPSVLA
ASDHQPLFSVRVTKHTGLVVAFYQQSYTVSGTFAQCETALREAQQHNLVVGWWGVASLVL
WNWIAITNNRSARKALHRAAADRGYNTGGT
selected fasta
>[possible conserved transmembrane protein]
ATGTCACATCCGTACACCAACGCGCAGCCGCACCACTACCCCTACCCGAACCCTCAGCAC
CCACACCCCTACCCCTACCCCCAGCGTCCTGCGTATCCGCCGCCGCCACAGGTTGGCTAC
TACCCTCCGCACGCCGCGGCGCCGTGGACGCCGCAGCCGACCGCTCCATCAGTGCTCGCC
GCGTCGGACCACCAGCCACTCTTCTCTGTCCGAGTGACTAAACACACTGGGCTCGTAGTG
GCTTTCTACCAGCAGAGCTACACTGTCTCGGGCACATTCGCCCAATGCGAAACCGCCCTG
CGCGAAGCCCAACAGCACAATCTCGTCGTCGGGTGGTGGGGAGTCGCATCGCTTGTTCTG
TGGAACTGGATCGCGATTACCAACAACCGCAGCGCCCGAAAAGCGTTGCACCGCGCTGCC
GCTGACCGTGGCTACAACACAGGTGGGACGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP
 [1-8]  0.49 Signal
Bacteria, Gram-negative   
TMHMM
 [108-127]  Transmembrane (i-o)
Transmembrane 1