close all open/close all

CDS information : MUP_00180


close this sectionLocation

Organism
StrainAgy99
Entry nameMycolactone
Contig
Start / Stop / Direction15,061 / 13,973 / - [in whole cluster]
15,061 / 13,973 / - [in contig]
Locationcomplement(13973..15061) [in whole cluster]
complement(13973..15061) [in contig]
TypeCDS
Length1,089 bp (362 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)probable forkhead-associated protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • MUP018c, -, len: 362 aa. Probable forkhead-associated protein, similar to several other M. tuberculosis conserved hypothetical ala-rich proteins e.g. P96214|Rv3863 Hypothetical protein (392 aa), fasta scores: opt: 525, E(): 1.9e-25, (33.602% identity in 372 aa overlap); O50389|Rv3360 Hypothetical protein (122 aa), fasta scores: opt: 198, E(): 3.4e-05, (37.113% identity in 97 aa overlap); and similar to the N-terminus of O65934|Rv1747 hypothetical 92.2 kDa protein (ABC transporter, ATP-binding protein (865 aa), fasta scores: opt: 207, E(): 4.3e-05, (37.255% identity in 102 aa overlap). Contains a Prosite match to entries PS50006 FHA_DOMAIN Forkhead-associated (FHA) domain and PS50310 ALA_RICH Alanine-rich region. And a Pfam match to entry PF01381 HTH_3, Helix-turn-helix.

close this sectionSequence

selected fasta
>[probable forkhead-associated protein]
MQQPTEHTTPMDSLAPPALVIKTPHQAFTAHAAQGPVVIGRDAPAQVRIPDERISRAHVR
VTYTSTGWVAVDMSSNGTFVNGVQQATIPITDGLTIHLGHPLEGIAISFSYTIAPPLAVD
DATEHIEDTSDPKMVRVGAEIAARREELGLPKRELDRRGVVGQATMTDIEKGRRFPRPFT
RDKIEAVLGWPRGHIMWLYEQDIQPDEERTHVLTATTPVPEITGATKMALKGFTAAADSL
PPEDDPAFTDRVGALLADLRELESVAASATHSAHGTSAAALVLSDVRKLYKALMLRAAGA
PGATLGQRFYAARYRAELTTQDAAAAAGLPVAIIEAAEADAPLDPAATAAVQALLTSLLS
QR
selected fasta
>[probable forkhead-associated protein]
ATGCAACAGCCCACAGAGCACACGACGCCAATGGATTCTTTGGCCCCGCCCGCGCTGGTG
ATTAAGACACCACACCAAGCCTTTACCGCTCATGCGGCCCAAGGGCCGGTCGTGATCGGC
CGCGACGCTCCGGCCCAGGTTCGCATCCCCGACGAGCGGATTTCGCGCGCCCACGTTCGG
GTGACCTACACCTCGACGGGCTGGGTTGCCGTCGACATGAGCAGCAACGGCACCTTTGTC
AACGGTGTCCAACAGGCCACCATTCCGATCACCGATGGACTGACGATCCATCTCGGACAC
CCCCTGGAAGGGATTGCGATCTCCTTCAGCTATACCATTGCACCGCCGCTGGCTGTCGAC
GATGCCACCGAACACATCGAAGACACCAGTGATCCCAAGATGGTGCGCGTGGGCGCCGAA
ATCGCGGCGCGACGCGAAGAACTTGGACTGCCCAAGCGTGAACTGGACAGGCGCGGAGTC
GTCGGGCAGGCCACCATGACCGATATTGAGAAAGGTCGGCGCTTTCCCCGCCCCTTCACC
CGCGACAAGATCGAGGCGGTACTGGGCTGGCCGCGCGGGCACATCATGTGGCTCTATGAG
CAAGATATCCAGCCCGACGAAGAGCGCACCCACGTCTTGACCGCCACCACTCCGGTGCCG
GAGATAACCGGAGCCACCAAGATGGCGCTCAAGGGATTCACCGCGGCGGCCGATTCGCTG
CCGCCAGAAGATGACCCCGCTTTCACCGACCGTGTTGGTGCGTTGTTGGCCGACCTACGC
GAGCTCGAAAGTGTCGCAGCCAGCGCGACGCACAGCGCCCACGGCACATCTGCGGCAGCG
TTGGTGCTCTCTGACGTTCGCAAGCTGTACAAGGCGTTGATGTTGCGCGCGGCCGGGGCG
CCCGGCGCCACGCTCGGTCAGCGGTTCTATGCAGCCCGATACCGCGCCGAACTGACCACG
CAGGACGCCGCCGCCGCCGCGGGCCTGCCCGTAGCGATCATCGAGGCGGCCGAAGCCGAC
GCGCCCCTTGACCCCGCTGCCACCGCCGCCGTGCAAGCACTGCTGACATCACTGCTGAGT
CAGCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000253 Forkhead-associated (FHA) domain (Domain)
 [37-99]  5.90000000000001e-13 PF00498
PF00498   FHA
 [37-85]  PS50006
PS50006   FHA_DOMAIN
 [36-85]  1.20000117458134e-11 SM00240
SM00240   FHA
 [9-115]  1.3e-20 G3DSA:2.60.200.20
G3DSA:2.60.200.20   FHA
IPR008984 SMAD/FHA domain (Domain)
 [1-136]  3.00000067992871e-22 SSF49879
SSF49879   SMAD_FHA
IPR010982 Lambda repressor-like, DNA-binding domain (Domain)
 [131-201]  4.99999811956429e-08 SSF47413
SSF47413   Lambda_like_DNA
 [137-191]  2.8e-10 G3DSA:1.10.260.40
G3DSA:1.10.260.40   G3DSA:1.10.260.40
SignalP
 [1-32]  0.272 Signal
Bacteria, Gram-negative   
 [1-32]  0.316 Signal
Bacteria, Gram-positive   
TMHMM No significant hit