close all open/close all

CDS information : MUP_00190


close this sectionLocation

Organism
StrainAgy99
Entry nameMycolactone
Contig
Start / Stop / Direction15,406 / 16,440 / + [in whole cluster]
15,406 / 16,440 / + [in contig]
Location15406..16440 [in whole cluster]
15406..16440 [in contig]
TypeCDS
Length1,035 bp (344 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)probable conserved membrane protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • MUP019, -, len: 344 aa. Probable conserved membrane protein, weakly similar to several membrane associated proteins from M. tuberculosis e.g. to the C-terminus of two probable serine/threonine-protein kinases Q11053|PKNH_MYCTU|Rv1266c (626 aa), fasta scores: opt: 483, E(): 3.7e-16, (29.032% identity in 341 aa overlap); and PKNJ_MYCTU|Q10697|Rv2088 (589 aa), fasta scores: opt: 315, E(): 5.4e-08, (25.649% identity in 308 aa overlap). Also weakly similar to P96858|Rv3576 Possible lipoprotein lppH from M. tuberculosis (237 aa), fasta scores: opt: 380, E(): 1.9e-11, (29.918% identity in 244 aa overlap). Contains a Prosite match to entry PS50099 PRO_RICH Proline-rich region. Contains a membrane spanning region between aa 102 to 124.

close this sectionSequence

selected fasta
>[probable conserved membrane protein]
MLGITFGLAPRRMITMSVDTEPTMPSHTWDARPSTGPTPVDPWGPPITTMGQPRPTNPQT
PEARYSWAPPPMAFQPGFGRAPGWPYPPATPNTAPHRASARIAAAVVGAALAVIALIVLI
TTVGGSTKPGAALTHTTPTVSAQPPSTTTTPPPPPPIAPAALAGLLLDTDTINALINSGE
LAVDPKHTTTKLFTDTADHPACGGVLVNASKQVYDGSGWVAAQTQALRDNTTRQHVVYES
VISYPSARTATKMVAQEAHNWQRCNGRSITTTATSYPAQTWFVATVDNHDGMLTALMNQE
GARGWACQHALTARNNIVIDIEVCGADITHQATAIAKKVAQNVH
selected fasta
>[probable conserved membrane protein]
ATGCTCGGTATCACATTCGGATTAGCGCCCAGGAGGATGATCACAATGTCGGTCGACACC
GAGCCCACGATGCCCAGTCACACATGGGATGCGCGGCCCTCAACCGGACCCACCCCGGTG
GATCCGTGGGGTCCACCCATCACCACGATGGGGCAGCCGAGGCCGACCAACCCGCAAACG
CCGGAGGCACGGTATTCGTGGGCCCCACCACCCATGGCCTTTCAACCCGGTTTTGGTCGG
GCTCCAGGCTGGCCGTATCCACCGGCCACACCAAACACTGCCCCGCATCGCGCGTCAGCA
CGCATCGCCGCCGCAGTAGTCGGCGCAGCGCTCGCAGTGATCGCGCTGATAGTGCTCATC
ACCACCGTCGGCGGATCAACCAAACCCGGCGCCGCCCTCACCCACACCACACCGACTGTC
TCAGCACAGCCACCGTCCACTACGACGACCCCGCCCCCGCCCCCGCCCATCGCGCCGGCA
GCCCTGGCAGGGCTGCTGCTCGACACAGACACCATCAACGCGCTGATAAACTCCGGAGAA
CTAGCGGTGGACCCAAAGCACACGACGACGAAGTTGTTCACCGACACCGCCGACCACCCG
GCATGCGGCGGAGTGTTGGTCAACGCCAGCAAACAGGTCTACGACGGCAGCGGATGGGTC
GCAGCGCAAACCCAAGCCCTGCGTGACAACACCACCCGACAACACGTCGTCTACGAATCG
GTAATCAGCTATCCCTCAGCACGCACCGCCACCAAAATGGTTGCCCAAGAAGCCCACAAC
TGGCAACGCTGCAACGGCCGATCCATAACCACCACCGCCACCAGCTACCCGGCCCAGACT
TGGTTTGTCGCCACCGTCGACAACCACGACGGCATGCTCACCGCGTTGATGAACCAAGAA
GGCGCTCGAGGCTGGGCCTGCCAGCACGCATTGACCGCACGCAACAACATCGTCATCGAC
ATTGAGGTATGCGGTGCCGACATCACCCATCAAGCCACCGCAATCGCCAAGAAGGTCGCC
CAAAATGTCCACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM
 [102-124]  Transmembrane (i-o)
Transmembrane 1