close all open/close all

CDS information : MUP_00200


close this sectionLocation

Organism
StrainAgy99
Entry nameMycolactone
Contig
Start / Stop / Direction16,430 / 16,612 / + [in whole cluster]
16,430 / 16,612 / + [in contig]
Location16430..16612 [in whole cluster]
16430..16612 [in contig]
TypeCDS
Length183 bp (60 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)conserved hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • MUP020, -, len: 60 aa. Conserved hypothetical protein, some similarity to Q983E1 Hypothetical protein mll8367 from Rhizobium loti (Mesorhizobium loti) (91 aa), fasta scores: opt: 92, E(): 4.5, (35.00% identity in 40 aa overlap).

close this sectionSequence

selected fasta
>[conserved hypothetical protein]
MSTDSQSLGNDQHLERKPTEPRAGKGCRPALQPQTDVIVMAVLSLPVVPITPLFQGWCSL
selected fasta
>[conserved hypothetical protein]
ATGTCCACTGACTCACAATCCCTCGGGAATGACCAACATCTTGAGCGCAAGCCGACCGAG
CCACGCGCCGGAAAAGGTTGCCGCCCGGCGCTGCAACCGCAAACCGATGTGATCGTGATG
GCTGTCCTATCTCTGCCTGTCGTGCCGATCACGCCCCTATTTCAAGGATGGTGCTCGCTA
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP No significant hit
TMHMM No significant hit