close all open/close all

CDS information : MUP_00210


close this sectionLocation

Organism
StrainAgy99
Entry nameMycolactone
Contig
Start / Stop / Direction16,609 / 16,872 / + [in whole cluster]
16,609 / 16,872 / + [in contig]
Location16609..16872 [in whole cluster]
16609..16872 [in contig]
TypeCDS
Length264 bp (87 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)possible transcriptional regulatory protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • MUP021, -, len: 87 aa. Possible transcriptional regulatory protein, similar to other possible WhiB-like regulatory proteins e.g. O69649|Rv3681c Probable whiB4 from M. tuberculosis (118 aa), fasta scores: opt: 141, E(): 0.001, (44.681% identity in 47 aa overlap); P96215|Rv3862c Possible whiB6 from M. tuberculosis (116 aa), fasta scores: opt: 133, E(): 0.0054, (29.412% identity in 85 aa overlap). Also weakly similar to other putative regulatory proteins e.g. Q9S2B9 Putative regulatory protein from Streptomyces coelicolor (112 aa), fasta scores: opt: 115, E(): 0.11, (34.211% identity in 76 aa overlap). Contains a Pfam match to entry PF02467 Transcription factor WhiB.

close this sectionSequence

selected fasta
>[possible transcriptional regulatory protein]
MTAANPVKLGVGLCVYDDEDKWFSGYSSNRKAAAICANCPIIVSCAERALRLQVTDGVWV
TVVMPGSRHTDALEQARARLRRVIEHY
selected fasta
>[possible transcriptional regulatory protein]
ATGACCGCGGCGAACCCCGTAAAACTCGGTGTCGGCCTTTGCGTGTATGACGACGAAGAC
AAGTGGTTCAGCGGCTACAGTTCCAATCGAAAAGCGGCTGCGATCTGTGCGAACTGCCCG
ATCATCGTCAGCTGCGCCGAGAGGGCTCTTCGGCTGCAAGTCACCGACGGTGTCTGGGTA
ACGGTGGTCATGCCCGGTTCACGTCACACCGATGCTCTCGAGCAAGCGCGTGCACGCCTG
CGTCGAGTTATCGAGCACTACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003482 Transcription factor WhiB (Family)
 [12-60]  5.10000000000001e-09 PF02467
PF02467   Whib
SignalP No significant hit
TMHMM No significant hit