close all open/close all

CDS information : MUP_00230


close this sectionLocation

Organism
StrainAgy99
Entry nameMycolactone
Contig
Start / Stop / Direction19,404 / 18,772 / - [in whole cluster]
19,404 / 18,772 / - [in contig]
Locationcomplement(18772..19404) [in whole cluster]
complement(18772..19404) [in contig]
TypeCDS
Length633 bp (210 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • MUP023c, -, len: 210 aa. Hypothetical protein.

close this sectionSequence

selected fasta
>[hypothetical protein]
MSPRPKPKAPRTPPEQLIREPDDNIDYSGTLWRVHRTEGEHILPWNTLRTFGPLPSMRWD
PHPGPQPSSHADGVLYAAADVATSLAEVYQTTRVIDTRANAPTLTAWQPQRRLRLLDLSG
TWLLRNTASAALLAAPRSICRRWARAIYTTWPELDGLYVPSTMTGRPNIVLWNAAADSIP
TMPSFTRPLTHPLVWSIGQAAAAEIGYRIQ
selected fasta
>[hypothetical protein]
GTGAGCCCACGGCCCAAACCGAAGGCGCCACGAACGCCCCCAGAACAGCTCATCCGGGAA
CCTGATGACAACATCGACTACAGCGGCACGCTGTGGAGGGTCCATCGCACCGAAGGCGAG
CACATACTGCCGTGGAACACGCTGCGCACCTTCGGTCCGCTGCCTTCGATGCGCTGGGAT
CCACACCCGGGCCCTCAGCCCAGCTCGCACGCTGACGGGGTCCTATACGCCGCCGCCGAT
GTCGCAACCAGCCTCGCTGAGGTCTACCAAACAACACGCGTGATCGACACCCGCGCCAAC
GCTCCGACTCTAACCGCCTGGCAACCCCAACGGAGACTGCGTCTGCTCGACTTGTCAGGA
ACATGGCTGCTCCGCAACACCGCTTCGGCTGCATTGTTGGCCGCACCCCGATCCATATGT
CGACGGTGGGCTCGCGCTATCTACACGACCTGGCCTGAACTCGACGGCCTCTACGTCCCG
TCGACCATGACCGGGCGCCCTAACATCGTGCTGTGGAATGCCGCCGCGGATTCCATACCC
ACGATGCCATCATTCACCCGCCCCCTCACCCACCCGCTCGTATGGTCGATCGGACAGGCC
GCAGCCGCCGAGATCGGCTACCGCATCCAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR014914 RES (Family)
 [59-183]  0.00093 SM00953
SM00953   no description
 [30-178]  5.1e-26 PF08808
PF08808   RES
SignalP
 [1-9]  0.535 Signal
Bacteria, Gram-positive   
 [1-39]  0.049 Signal
Eukaryota   
TMHMM No significant hit