close all open/close all

CDS information : MUP_00240


close this sectionLocation

Organism
StrainAgy99
Entry nameMycolactone
Contig
Start / Stop / Direction19,988 / 19,401 / - [in whole cluster]
19,988 / 19,401 / - [in contig]
Locationcomplement(19401..19988) [in whole cluster]
complement(19401..19988) [in contig]
TypeCDS
Length588 bp (195 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • MUP024c, -, len: 195 aa. Hypothetical protein.

close this sectionSequence

selected fasta
>[hypothetical protein]
MGGSTAPALGALLARHQIDLTVEEVLDELDSGFAAIPGAATLSTTEVDFLRANAGPGTAA
VIDAWSASNERPARARIALQQLTGALSGSVSIKEAATMLGVDRSRVSRRITAKALWAFDL
QGNRRIPRWQFLSNELLPGLDVIVPAIARGTTPAVLDVFMHTPQPDFDDRTPIEHLAAGG
DPALVAGFIADLARW
selected fasta
>[hypothetical protein]
ATGGGTGGATCGACTGCTCCTGCGCTGGGTGCGCTACTCGCTAGACACCAGATTGACCTG
ACGGTCGAAGAGGTCCTCGACGAACTCGACTCCGGATTTGCGGCCATCCCCGGGGCAGCC
ACTCTGTCGACGACAGAAGTGGACTTCCTCCGCGCGAACGCCGGACCCGGTACAGCAGCG
GTGATCGACGCATGGTCGGCGAGCAACGAACGCCCGGCCCGCGCCCGCATCGCGTTGCAG
CAGCTCACCGGTGCGCTCTCAGGATCGGTCAGCATAAAAGAAGCCGCCACGATGCTCGGC
GTAGACCGCTCCCGCGTGTCGCGGCGCATCACCGCAAAAGCACTATGGGCCTTCGATCTC
CAAGGAAACCGACGCATCCCAAGGTGGCAGTTCCTCAGCAACGAACTGCTTCCCGGCTTG
GACGTGATCGTCCCCGCGATAGCGCGGGGCACCACCCCCGCTGTTTTGGATGTATTCATG
CACACCCCGCAACCCGACTTCGACGACCGCACGCCGATCGAGCATCTGGCCGCCGGTGGC
GACCCCGCGCTGGTCGCCGGATTCATAGCAGATCTCGCGCGCTGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP No significant hit
TMHMM No significant hit