close all open/close all

CDS information : MUP_00250


close this sectionLocation

Organism
StrainAgy99
Entry nameMycolactone
Contig
Start / Stop / Direction20,718 / 22,457 / + [in whole cluster]
20,718 / 22,457 / + [in contig]
Location20718..22457 [in whole cluster]
20718..22457 [in contig]
TypeCDS
Length1,740 bp (579 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putative transposase
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • MUP025, -, len: 579 aa. Putative transposase, weakly similar to several putative transposases e.g. Q8R6J9 Transposase from Thermoanaerobacter tengcongensis (565 aa), fasta scores: opt: 315, E(): 5.2e-13, (22.095% identity in 525 aa overlap); O70063 Putative transposase from Mycobacterium smegmatis (503 aa), fasta scores: opt: 221, E(): 9.3e-07, (26.190% identity in 504 aa overlap); Q9Z681 Transposase from Mycoplasma mycoides subsp. mycoides SC (483 aa), fasta scores: opt: 221, E(): 9e-07, (23.288% identity in 365 aa overlap). Almost identical to MUP028 and highly similar to MUP037 but longer.

close this sectionSequence

selected fasta
>[putative transposase]
MAKPMAMHVARTPSAHVDKAGNARRYEAVLVRRSYRDGKKVRHQTLANLSKLPAHVIDVV
EASLKGQALVAPESVCEITRSLPHGHVAAVGAMARTLGLPALLGPRCRSRDLVLGLIISR
VLRPASKLATLAWWADTTLGEDLNATNASTGEIYEAMDWLLARQDAIEKQLAAKHLAASV
NPSRMALFDLSSSWMTGQCCDLAARGYSRDGKKGLPQIEYGLLTDPAGRPVAIRVFAGNT
ADPAAFTDIVEVVRERFGLDRLVLVGDRGMITSARIAALRELNNDPDTATGFGWITALRA
PAIAKLAGDDGPLQLSLFDTQDLATITHPDYPSERLIACRNPLLATQRARKRAELLTVTE
AALAPIIAAVACGRLAGAGRIGVKVGKVLAKFKMAKHFHLDITDTTLTVTRDQTKIDAEA
ALDGIYVLRTSVTANELDPAAVVVSYKNLANVERDFRSIKTDDLDLRPIHHRLDDRVKAH
ILIAMLACYLVWHLRKAWAPMTYTDENPPARENPVTPAQRSAAAKTKAARHQDANGATLR
SFSGLLEHLATLTRNDVNFTHTTNPIPMLATPPRPTTRL
selected fasta
>[putative transposase]
ATGGCCAAGCCGATGGCGATGCACGTAGCCCGTACGCCGAGTGCGCATGTGGATAAGGCG
GGCAACGCGCGCCGCTACGAGGCGGTGCTGGTGCGGCGAAGCTATCGCGACGGCAAAAAG
GTTCGACATCAGACCCTGGCGAATCTGTCCAAGCTGCCTGCCCACGTTATCGACGTGGTC
GAGGCCAGCCTCAAGGGCCAGGCGCTGGTAGCGCCCGAGTCGGTCTGTGAGATCACACGT
TCACTGCCCCATGGGCATGTGGCCGCGGTGGGGGCCATGGCACGCACGCTGGGGCTGCCC
GCACTGTTGGGGCCGCGGTGTCGGTCCCGCGATCTGGTGTTGGGGTTGATCATCTCGCGG
GTGCTCCGACCTGCCTCCAAGCTGGCCACGCTGGCCTGGTGGGCCGACACCACACTCGGC
GAAGATTTGAACGCGACCAACGCATCGACCGGCGAGATCTATGAGGCGATGGACTGGCTG
CTCGCCCGTCAAGACGCGATCGAAAAACAGTTGGCTGCCAAACACCTGGCCGCCTCGGTC
AATCCGTCGCGGATGGCGCTGTTTGACTTGTCCTCATCGTGGATGACCGGCCAATGCTGC
GATCTGGCTGCACGCGGGTATTCCCGTGACGGTAAGAAGGGCCTACCCCAAATCGAGTAC
GGGCTGCTCACCGACCCCGCTGGGCGCCCAGTGGCGATACGGGTGTTCGCCGGTAACACC
GCTGACCCGGCCGCGTTCACCGACATCGTCGAGGTGGTGCGTGAGCGCTTCGGGCTGGAC
CGGCTGGTTCTTGTCGGTGATCGCGGCATGATCACCTCCGCGCGTATCGCCGCGCTGCGC
GAACTCAACAACGACCCCGACACCGCAACCGGTTTCGGCTGGATCACCGCGCTGCGTGCA
CCGGCGATCGCCAAGCTCGCCGGTGATGACGGGCCGCTGCAACTGAGCCTGTTCGATACC
CAAGACCTGGCCACCATCACCCACCCCGACTATCCCAGCGAACGACTCATCGCGTGTCGT
AACCCACTGTTGGCGACCCAACGCGCCCGCAAACGTGCCGAATTGCTGACCGTCACCGAG
GCTGCGCTGGCGCCGATCATCGCCGCAGTAGCTTGTGGCCGGCTGGCCGGCGCCGGGCGG
ATCGGGGTGAAAGTTGGCAAAGTACTGGCAAAGTTCAAGATGGCCAAACACTTCCATCTC
GACATCACCGACACCACACTGACCGTGACGCGTGACCAAACCAAGATCGATGCCGAAGCC
GCCCTGGATGGGATCTACGTGCTGCGCACCAGCGTCACCGCCAACGAGCTTGACCCCGCC
GCAGTCGTGGTCAGCTATAAAAACCTCGCCAACGTCGAACGCGACTTCCGCAGCATCAAA
ACCGACGACCTGGACCTACGCCCCATTCATCACCGACTCGACGACCGGGTCAAAGCCCAC
ATCCTGATCGCCATGCTCGCCTGCTACCTGGTGTGGCACCTACGCAAAGCCTGGGCACCC
ATGACCTATACCGACGAAAACCCACCAGCCCGGGAAAACCCTGTCACACCCGCCCAACGC
TCAGCTGCCGCCAAAACCAAAGCCGCACGCCACCAAGACGCCAACGGAGCCACGCTACGC
AGCTTCAGCGGCCTGCTCGAGCACCTGGCAACCCTGACCCGCAACGACGTCAACTTCACC
CACACCACCAACCCGATCCCGATGCTCGCCACCCCACCCCGACCAACAACGCGCCTTTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002559 Transposase, IS4-like (Domain)
 [220-489]  2.8e-08 PF01609
PF01609   DDE_Tnp_1
IPR012337 Ribonuclease H-like domain (Domain)
 [424-495]  8.29999581180008e-07 SSF53098
SSF53098   RNaseH_fold
SignalP No significant hit
TMHMM No significant hit