close all open/close all

CDS information : MUP_00270


close this sectionLocation

Organism
StrainAgy99
Entry nameMycolactone
Contig
Start / Stop / Direction24,980 / 24,162 / - [in whole cluster]
24,980 / 24,162 / - [in contig]
Locationcomplement(24162..24980) [in whole cluster]
complement(24162..24980) [in contig]
TypeCDS
Length819 bp (272 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putative transposase
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • MUP027c, -, len: 272 aa. Putative transposase, similar to several putative transposases e.g. P71924|Rv2424c Probable transposase for IS1558 from Mycobacterium tuberculosis (333 aa), fasta scores: opt: 755, E(): 1.7e-42, (45.118% identity in 297 aa overlap); Q8RAU1 Transposase from Thermoanaerobacter tengcongensis (405 aa), fasta scores: opt: 756, E(): 1.7e-42, (42.517% identity in 294 aa overlap). Contains a Pfam match to entry PF02371, Transposase IS116/IS110/IS902 family.

close this sectionSequence

selected fasta
>[putative transposase]
MTRERTREIQRLEKLLEDAGIKLSSVAADLNGKSSRAMLEALLAGETDTAVMADLAEKQL
RRKIPQLTEALYGRFTAHHAFLARMHLNLIDQHTAAIEALTERIEVVMQPFRGFRDLICT
IPGIGGFTADVVVAETGADMTKFPTAQHLASRAGKTPGNNESAGKVKSRRTRPGNPYLQG
ALGTAAMSISHTRDTYLAAKYRRVTARRGPLRANVAVQRALLVAIWNIATTNTGYHDPGG
DYFTRLNPQKARHNAVRQLEAMGYHVTLDRVS
selected fasta
>[putative transposase]
GTGACGCGGGAACGCACCCGCGAGATCCAGCGCCTGGAGAAACTCCTCGAAGACGCCGGG
ATCAAACTGTCCTCGGTCGCCGCCGATCTCAACGGCAAGTCGTCACGGGCGATGCTGGAA
GCGTTGCTCGCCGGTGAGACCGACACGGCGGTGATGGCCGATCTGGCCGAGAAGCAGTTG
CGCAGAAAAATCCCGCAGCTGACCGAAGCCCTCTACGGTCGGTTCACCGCTCATCACGCG
TTTTTGGCCCGCATGCACCTGAACTTGATCGACCAGCACACCGCGGCCATCGAGGCACTC
ACCGAGCGGATCGAGGTGGTGATGCAACCCTTTCGCGGCTTCCGGGATCTGATCTGCACC
ATCCCCGGCATCGGTGGATTCACTGCCGACGTCGTGGTCGCCGAGACCGGAGCCGACATG
ACCAAATTTCCTACCGCACAACATCTTGCGTCGCGGGCGGGCAAGACCCCGGGCAACAAC
GAATCAGCCGGCAAGGTGAAATCGCGACGCACACGGCCGGGCAACCCCTACCTCCAAGGA
GCACTGGGTACCGCGGCGATGTCGATCTCGCACACCCGCGACACCTACCTGGCGGCCAAG
TATCGCCGGGTCACTGCCCGCCGCGGCCCTCTGCGGGCCAACGTCGCCGTGCAACGCGCA
CTGCTAGTCGCGATCTGGAACATCGCCACCACCAACACCGGCTACCACGATCCCGGAGGG
GACTACTTCACCCGGCTCAACCCCCAGAAAGCGCGACACAACGCTGTTCGCCAACTCGAA
GCCATGGGCTACCACGTCACCCTCGACCGAGTGTCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003346 Transposase, IS116/IS110/IS902 (Family)
 [116-201]  4.29999999999998e-19 PF02371
PF02371   Transposase_20
SignalP No significant hit
TMHMM No significant hit