close all open/close all

CDS information : MUP_00300


close this sectionLocation

Organism
StrainAgy99
Entry nameMycolactone
Contig
Start / Stop / Direction28,026 / 27,322 / - [in whole cluster]
28,026 / 27,322 / - [in contig]
Locationcomplement(27322..28026) [in whole cluster]
complement(27322..28026) [in contig]
TypeCDS
Length705 bp (234 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)probable transposase for the insertion element IS2404 (fragment)
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • MUP030c, -, len: 234 aa. Probable IS2404 transposase fragment, highly similar to O07439 Putative transposase from Mycobacterium ulcerans (327 aa), fasta scores: opt: 1839, E(): 2.4e-119, (92.949% identity in 312 aa overlap). Note that this homology extends across the stop codon and directly into MUP029, suggesting a possible readthrough of the TAG stop codon. No sequence errors have been identified and this insertion sequence containing the internal stop codon is repeated at two other locations on the plasmid, MUP047 + MUP048 and MUP062 + MUP063.

close this sectionSequence

selected fasta
>[probable transposase for the insertion element IS2404 (fragment)]
MALLAIAVLATAAGMRGYAGFATWAATASDDVLAQVGVRFRRPSEKTFRAVLSRLDPADL
NARMGSYFTAHVASSDPSGLVPIALDGKMLRGALRAKATATHLVSVFAHRARLVLGQLAV
AEKSNEIPCVCALLTLLPDNLRWLVTVDAMHTQVVTAKLICATLKSHYLMIVKSNQAKIL
ARITALPWAEVPAAATDDSRGHGRVKTRTLQIITTARGIGFPYAKQIIRITRER
selected fasta
>[probable transposase for the insertion element IS2404 (fragment)]
ATGGCTTTGTTGGCGATCGCGGTTCTGGCCACTGCCGCGGGGATGCGCGGCTATGCTGGT
TTTGCCACATGGGCGGCCACCGCTTCCGATGATGTGTTGGCCCAAGTAGGGGTCCGGTTC
CGGCGGCCCAGTGAGAAGACCTTCCGCGCTGTTTTGTCTCGGCTAGACCCCGCCGACCTC
AACGCCAGGATGGGCAGTTACTTCACTGCACACGTGGCCAGCAGCGACCCCAGTGGATTG
GTGCCGATCGCGTTGGACGGCAAGATGCTGCGTGGTGCTTTACGCGCCAAAGCGACAGCC
ACGCATCTCGTGTCGGTGTTCGCCCACCGTGCCCGATTGGTGCTCGGTCAACTCGCTGTC
GCCGAGAAAAGCAATGAAATTCCCTGCGTATGTGCCCTGCTCACGCTGCTGCCGGATAAC
TTGCGGTGGCTGGTTACCGTGGATGCGATGCATACCCAGGTCGTCACCGCGAAGTTGATC
TGCGCCACCTTGAAGTCGCACTACCTGATGATCGTCAAGTCCAACCAAGCCAAAATACTT
GCCCGTATCACCGCGCTGCCCTGGGCCGAGGTACCCGCAGCCGCTACCGACGACTCCCGC
GGCCACGGCCGTGTCAAGACCCGCACCCTGCAAATCATCACCACTGCACGAGGAATCGGC
TTCCCCTACGCAAAACAAATCATCCGGATCACTCGTGAACGCTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP
 [1-25]  0.991 Signal
Bacteria, Gram-negative   
 [1-19]  0.998 Signal
Eukaryota   
 [1-21]  0.419 Signal
Bacteria, Gram-positive   
TMHMM No significant hit