close all open/close all

CDS information : MUP_00310


close this sectionLocation

Organism
StrainAgy99
Entry nameMycolactone
Contig
Start / Stop / Direction29,720 / 28,386 / - [in whole cluster]
29,720 / 28,386 / - [in contig]
Locationcomplement(28386..29720) [in whole cluster]
complement(28386..29720) [in contig]
TypeCDS
Length1,335 bp (444 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)probable transposase for the insertion element IS2606
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • MUP031c, -, len: 444 aa. Probable transposase for IS2606, highly similar to Q9ZG97 Probable transposase from Mycobacterium ulcerans (444 aa), fasta scores: opt: 2879, E(): 6.2e-188, (98.423% identity in 444 aa overlap); and to O05912 Hypothetical 48.7 kDa protein (IS1554, transposase) from M. tuberculosis (439 aa), fasta scores: opt: 2055, E(): 5e-132, (70.805% identity in 435 aa overlap).

close this sectionSequence

selected fasta
>[probable transposase for the insertion element IS2606]
MMTKTVVAVQPSQNHEDEAGAVAAIDVPSSRDVDELEVARELVRQAREAGVGLTGPGGLL
KAMTKTVIETALDEELSEHLGYDRHDRAGYGNGNSRNGTRSKTVLTDACGSIEIDVPRDR
AGTFEPKIVEKRQRRLTDVDEVVLSLYARGLTTGEISAHFAHIYDAAVSKDTVSRITDRV
LEEMTAWHTRPLERVYAAVFIDALHVKIRDGQVGPRPVYAAVGVDLAGHRDVLGMWAGEG
DGESAKYWLAVLTELKNRGVADIFFLVCDGLKGLPDSVSAVFPDTVVQTCIIHLIRGTFR
YAGRQHHTAIARALKPIYTAVNAAAAAEALDAFDTEWGHRYPAAIRLWRNAWNEFIPFLD
YDTEIRKVICSTNAIEWLNARYRRAIRARGHFPTEQSALKCLYLVTRSLDPTGTGQKRWT
MRWKPALNAFAITFADRMPGSETT
selected fasta
>[probable transposase for the insertion element IS2606]
ATGATGACCAAGACTGTCGTGGCTGTGCAGCCATCACAAAACCACGAAGATGAGGCCGGC
GCCGTGGCGGCTATTGACGTTCCCAGTAGTCGCGATGTTGATGAGTTAGAAGTCGCCCGC
GAGTTGGTGCGCCAGGCCCGCGAGGCCGGCGTTGGGTTAACCGGGCCTGGCGGATTGCTC
AAGGCGATGACCAAAACGGTCATTGAGACCGCTTTGGATGAGGAACTGTCCGAGCACCTT
GGATATGACCGCCACGATCGGGCTGGGTATGGCAATGGCAACTCGCGCAACGGAACCCGC
TCGAAAACGGTGCTCACTGATGCGTGCGGTTCCATTGAGATCGATGTCCCACGGGATCGG
GCAGGCACATTCGAGCCGAAGATCGTCGAAAAACGCCAGCGTAGGTTGACCGACGTCGAT
GAGGTGGTGTTGTCGCTGTATGCCCGCGGGTTGACCACCGGGGAGATCAGCGCCCATTTC
GCCCACATCTACGACGCGGCGGTGTCCAAGGACACCGTTAGCCGGATCACCGACCGCGTT
CTCGAGGAGATGACCGCCTGGCATACCCGCCCGCTAGAGCGCGTATACGCCGCGGTGTTC
ATCGACGCCCTGCACGTCAAGATCCGCGACGGCCAAGTCGGCCCCCGGCCGGTCTACGCC
GCGGTCGGGGTCGATCTGGCCGGACACCGTGACGTGCTGGGCATGTGGGCCGGTGAAGGT
GACGGCGAATCGGCCAAGTACTGGCTGGCAGTGCTGACGGAGTTGAAAAACCGCGGCGTG
GCCGACATCTTCTTCCTGGTCTGTGACGGCCTCAAAGGACTGCCGGACTCGGTGAGCGCG
GTCTTCCCCGACACCGTGGTGCAAACCTGCATCATCCACTTGATCCGCGGCACGTTCCGC
TACGCCGGGCGCCAGCACCACACCGCGATCGCCCGGGCGCTCAAGCCGATCTACACCGCG
GTCAACGCTGCTGCGGCCGCCGAAGCCTTAGATGCCTTCGACACCGAATGGGGACACCGC
TACCCAGCGGCAATTCGATTGTGGCGCAACGCCTGGAATGAGTTCATCCCATTCCTGGAC
TACGACACCGAGATAAGGAAGGTGATTTGTTCGACCAATGCCATTGAATGGCTCAACGCC
CGCTACCGCCGTGCGATCAGGGCGCGTGGTCATTTCCCCACCGAGCAGTCCGCCCTGAAA
TGCCTATACTTGGTCACCCGGTCGCTAGATCCAACCGGAACCGGACAGAAGCGATGGACG
ATGCGCTGGAAACCAGCATTGAACGCCTTCGCGATCACCTTCGCCGACCGCATGCCAGGA
AGCGAAACCACCTAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001207 Transposase, mutator type (Family)
 [269-293]  PS01007
PS01007   TRANSPOSASE_MUTATOR
 [52-410]  1.29999999999998e-126 PF00872
PF00872   Transposase_mut
SignalP No significant hit
TMHMM No significant hit