close all open/close all

CDS information : MUP_00340


close this sectionLocation

Organism
StrainAgy99
Entry nameMycolactone
Contig
Start / Stop / Direction73,547 / 73,008 / - [in whole cluster]
73,547 / 73,008 / - [in contig]
Locationcomplement(73008..73547) [in whole cluster]
complement(73008..73547) [in contig]
TypeCDS
Length540 bp (179 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putative transposase
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • MUP034c, -, len: 179 aa. Putative transposase, weakly similar to several transposases from Xanthomonas e.g. Q8NL03 ISxac2 transposase from plasmid pXAC33 and pXAC64 of Xanthomonas axonopodis (275 aa), fasta scores: opt: 214, E(): 5.5e-07, (33.766% identity in 146 aa overlap); Q8PCU3 ISxcC1 transposase from Xanthomonas campestris (255 aa), fasta scores: opt: 198, E(): 3.8e-06, (34.286% identity in 105 aa overlap). Also weakly similar to Q9X9H9 IS1400 transposase B from Yersinia enterocolitica (294 aa), fasta scores: opt: 202, E(): 2.8e-06, (38.095% identity in 105 aa overlap). Almost identical to MUP042. Contains a Pfam match to entry PF00665 rve Integrase core domain.

close this sectionSequence

selected fasta
>[putative transposase]
MAMDFQFDFTTDSKAVKIASMVDEHIRESLLNIVERSITAERLIAGLEWVFAAAGGPPKV
LRMDNGPELISQALRQFCDRKVGLCYIQPRTPWNNATSNRSTTGYEGTASTAAAGPTHSK
TAWSWTISTTNTIIGIVTPHWVTCPPRSRLPDAATLIAPWPIALWPVRSNDICVKGTRL
selected fasta
>[putative transposase]
GTGGCGATGGATTTCCAGTTCGACTTCACCACAGACAGCAAAGCGGTCAAGATCGCCTCA
ATGGTCGACGAGCACATCCGAGAATCGTTGCTGAACATCGTGGAGCGCTCGATTACCGCC
GAGCGGCTCATCGCCGGGCTCGAGTGGGTGTTCGCCGCGGCCGGCGGCCCACCGAAGGTG
CTGCGGATGGACAATGGCCCTGAGCTCATTTCCCAAGCGCTGCGACAGTTCTGCGACCGC
AAGGTAGGGCTGTGCTACATCCAGCCCAGAACCCCGTGGAACAACGCTACATCGAATCGT
TCAACAACCGGCTACGAAGGGACTGCCTCAACCGCAGCCGCTGGACCAACCCACTCGAAG
ACCGCGTGGTCATGGACGATTTCAACCACGAACACAATCATCGGCATCGTCACTCCGCAC
TGGGTTACCTGCCCCCCGCGGAGTAGGCTGCCCGATGCAGCCACACTCATTGCCCCGTGG
CCCATTGCCCTGTGGCCCGTGAGATCAAATGACATCTGCGTCAAAGGCACTCGGCTCTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001584 Integrase, catalytic core (Domain)
 [1-80]  PS50994
PS50994   INTEGRASE
 [6-98]  3.1e-10 PF00665
PF00665   rve
IPR012337 Ribonuclease H-like domain (Domain)
 [3-96]  8.1000073432326e-10 SSF53098
SSF53098   RNaseH_fold
SignalP No significant hit
TMHMM No significant hit