close all open/close all

CDS information : MUP_00350


close this sectionLocation

Organism
StrainAgy99
Entry nameMycolactone
Contig
Start / Stop / Direction74,138 / 74,851 / + [in whole cluster]
74,138 / 74,851 / + [in contig]
Location74138..74851 [in whole cluster]
74138..74851 [in contig]
TypeCDS
Length714 bp (237 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putative transposase
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • MUP035, -, len: 237 aa. Putative transposase, similar to several transposases from Streptomyces e.g. BAC68344|Q82Q86 Putative transposase from Streptomyces avermitilis (354 aa), fasta scores: opt: 551, E(): 5.1e-23, (52.299% identity in 174 aa overlap); O69923 Putative transposase from Streptomyces coelicolor (379 aa), fasta score: opt: 309, E(): 7.6e-10, (35.897% identity in 195 aa overlap). And also weakly similar to BAC18219|Q8FPT1 Putative transposase from Corynebacterium efficiens (446 aa), fasta scores: opt: 435, E(): 8.5e-17, (39.487% identity in 195 aa overlap);and O07182|Rv0797 Putative transposase of IS1547 from M. tuberculosis (364 aa), fasta scores: opt: 225, E(): 3.5e-05, (31.818% identity in 154 aa overlap). Highly similar to MUP043 but shorter. Contains a Pfam match to entry PF01548 Transposase_9, Transposase.

close this sectionSequence

selected fasta
>[putative transposase]
MGRSSRAIIGGVDTHAATHHGAVIDSRGRLLADAEYPASGRGYAAMLTWMRSKGNLTKVG
VEGTGAYGAGLARYLHEQGVEVLEVPRPDRRIRRQRGKSDPIDAEAAARTVLAGRASGAS
KLVDGPIEAIRMLRVARSDAVKAKTAAVNALRAMLITTHQDANGATLRSFSGLLEHLATL
TRNDVNFTHTTNPIPMLATPPPTNNAPLTSSEPPSPSPAPRSHQRQPTKPQNPQVNS
selected fasta
>[putative transposase]
ATGGGCCGGAGTTCACGAGCCATCATCGGCGGCGTGGATACGCACGCAGCAACTCATCAC
GGCGCGGTCATCGATTCACGTGGCCGGCTGCTCGCTGACGCCGAATACCCGGCCTCGGGG
CGCGGTTATGCCGCGATGCTGACGTGGATGCGCAGCAAAGGAAACCTCACGAAAGTTGGC
GTCGAAGGAACCGGCGCCTACGGGGCCGGGCTTGCCCGCTACCTGCACGAGCAGGGCGTC
GAGGTGCTTGAGGTGCCCCGCCCCGACCGGCGCATCCGTCGGCAGCGCGGCAAGAGCGAC
CCGATCGATGCTGAAGCCGCGGCACGAACCGTCTTGGCAGGTCGGGCAAGCGGAGCTTCG
AAGCTAGTCGATGGGCCGATCGAAGCCATCCGCATGCTGCGGGTAGCCCGCAGCGATGCG
GTCAAAGCCAAAACCGCCGCGGTCAACGCCCTGCGCGCGATGCTCATCACTACGCACCAA
GACGCCAACGGAGCCACGCTACGCAGCTTCAGCGGCCTGCTCGAGCACCTGGCAACCCTG
ACCCGCAACGACGTCAACTTCACCCACACCACCAACCCGATCCCGATGCTCGCCACCCCA
CCCCCGACCAACAACGCGCCTTTGACCTCATCGGAACCACCATCCCCCTCACCAGCGCCG
CGTAGCCACCAACGCCAACCCACCAAACCCCAAAACCCGCAGGTCAATTCATAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002525 Transposase, IS111A/IS1328/IS1533, N-terminal (Domain)
 [10-149]  7.29999999999999e-27 PF01548
PF01548   DEDD_Tnp_IS110
IPR016040 NAD(P)-binding domain (Domain)
 [55-153]  9.3e-05 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit