close all open/close all

CDS information : MUP_00370


close this sectionLocation

Organism
StrainAgy99
Entry nameMycolactone
Contig
Start / Stop / Direction76,556 / 77,911 / + [in whole cluster]
76,556 / 77,911 / + [in contig]
Location76556..77911 [in whole cluster]
76556..77911 [in contig]
TypeCDS
Length1,356 bp (451 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putative transposase
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • MUP037, -, len: 451. Putative transposase, weakly similar to several transposases from Thermoanaerobacter tengcongensis e.g. Q8R7J7 Transposase (565 aa), fasta scores: opt: 296, E(): 1.8e-10, (22.826% identity in 368 aa overlap); and Q8R6J9 Transposase (565 aa), fasta scores: opt: 292, E(): 3.5e-10, (22.283% identity in 368 aa overlap). And also weakly similar to O70063 Putative transposase from Mycobacterium smegmatis (503 aa), fasta scores: opt: 203, E(): 9.1e-05, (26.790% identity in 377 aa overlap). And highly similar to MUP025 and MUP028 but shorter.

close this sectionSequence

selected fasta
>[putative transposase]
MNATNASTGEIYEAMDWLLARQDAIEKQLAAKHLAASVNPSRMALFDLSSSWMTGQCCDL
AARGYSRDGKKGLPQIEYGLLTDPAGRPVAIRVFAGNTADPAAFTDIVEVVRERFGLDRL
VLVGDRGMITSARIAALRELNNDPDTATGFGWITALRAPAIAKLAGDDGPLQLSLFDTQD
LATITHPDYPSERLIACRNPLLATQRARKRAELLTVTEAALAPIIAAVACGRLAGAGRIG
VKVGKVLAKFKMAKHFHLDITDTTLTVTRDQTKIDAEAALDGIYVLRTSVTANELDPAAV
VVSYKNLANVERDFRSIKTDDLDLRPIHHRLDDRVKAHILIAMLACYLVWHLRKAWAPMT
YTDENPPARENPVTPAEGTTSPGSTPRKRDTTLFANSKPWATTSPSTERPDRSPSKRTSR
QSSRQVNKFTDASSAKRNVSTPAVGAQSGNL
selected fasta
>[putative transposase]
TTGAACGCGACCAACGCATCGACCGGCGAGATCTATGAGGCGATGGACTGGCTGCTCGCC
CGTCAAGACGCGATCGAAAAACAGTTGGCTGCCAAACACCTGGCCGCCTCGGTCAATCCG
TCGCGGATGGCGCTGTTTGACTTGTCCTCATCGTGGATGACCGGCCAATGCTGCGATCTG
GCTGCACGCGGGTATTCCCGTGACGGTAAGAAGGGCCTACCCCAAATCGAGTACGGGCTG
CTCACCGACCCCGCTGGGCGCCCAGTGGCGATACGGGTGTTCGCCGGTAACACCGCTGAC
CCGGCCGCGTTCACCGACATCGTCGAGGTGGTGCGTGAGCGCTTCGGGCTGGACCGGCTG
GTTCTTGTCGGTGATCGCGGCATGATCACCTCCGCGCGTATCGCCGCGCTGCGCGAACTC
AACAACGACCCCGACACCGCAACCGGTTTCGGCTGGATCACCGCGCTGCGTGCACCGGCG
ATCGCCAAGCTCGCCGGTGATGACGGGCCGCTGCAACTGAGCCTGTTCGATACCCAAGAC
CTGGCCACCATCACCCACCCCGACTATCCCAGCGAACGACTCATCGCGTGTCGTAACCCA
CTGTTGGCGACCCAACGCGCCCGCAAACGTGCCGAATTGCTGACCGTCACCGAGGCTGCG
CTGGCGCCGATCATCGCCGCAGTAGCTTGTGGCCGGCTGGCCGGCGCCGGGCGGATCGGG
GTGAAAGTTGGCAAAGTACTGGCAAAGTTCAAGATGGCCAAACACTTCCATCTCGACATC
ACCGACACCACACTGACCGTGACGCGTGACCAAACCAAGATCGATGCCGAAGCCGCCCTT
GATGGGATCTACGTGCTGCGCACCAGCGTCACCGCCAACGAGCTTGACCCCGCCGCAGTC
GTGGTCAGCTATAAAAACCTCGCCAACGTCGAACGCGACTTCCGCAGCATCAAAACCGAC
GACCTGGACCTACGCCCCATTCATCACCGACTCGACGACCGGGTCAAAGCCCACATCCTG
ATCGCCATGCTCGCCTGCTACCTGGTGTGGCACCTACGCAAAGCCTGGGCACCCATGACC
TATACCGACGAAAACCCACCAGCCCGGGAAAACCCTGTCACACCCGCGGAGGGGACTACT
TCACCCGGCTCAACCCCCAGAAAGCGTGACACAACGCTGTTCGCCAACTCGAAGCCATGG
GCTACCACGTCACCCTCGACCGAGCGTCCTGACCGCTCACCTTCCAAACGCACCTCACGT
CAATCTTCTCGTCAGGTGAACAAATTCACTGACGCGTCTTCTGCAAAGCGCAACGTAAGT
ACCCCGGCGGTGGGCGCTCAATCCGGAAATCTTTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002559 Transposase, IS4-like (Domain)
 [78-347]  1.4e-08 PF01609
PF01609   DDE_Tnp_1
IPR012337 Ribonuclease H-like domain (Domain)
 [282-353]  8.29999581180008e-07 SSF53098
SSF53098   RNaseH_fold
SignalP No significant hit
TMHMM No significant hit